Basic Vector Information
- Vector Name:
- pEBM136
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 7716 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Lynd L.
- Promoter:
- URA3
pEBM136 vector Map
pEBM136 vector Sequence
LOCUS V007669 7716 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007669 VERSION V007669 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7716) AUTHORS Lynd L. TITLE The identification of four histidine kinases that influence sporulation in Clostridium thermocellum JOURNAL Unpublished REFERENCE 2 (bases 1 to 7716) AUTHORS Mearls E. TITLE Direct Submission JOURNAL Submitted (03-OCT-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 7716) TITLE Direct Submission REFERENCE 4 (bases 1 to 7716) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-OCT-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7716 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 108..355 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(603..1191) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1365..2222) /label="AmpR" /note="beta-lactamase" CDS complement(2321..3121) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(3122..3342) /label="URA3 promoter" misc_feature 3370..3873 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" CDS complement(4105..5106) /label="repB" /note="RepB replication protein" regulatory 5592..6239 /label="gapD promoter" /note="gapD promoter" /regulatory_class="promoter" CDS 6240..6887 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 6906..7715 /codon_start=1 /product="Spo0A" /label="Spo0A" /note="master regulator of sporulation" /protein_id="AHC95143.1" /translation="MTSNKIRVVIADDNREFGDILYEYLNNQEDIEVVGVARDGIEAYE LIVEKLPDIAILDIIMPHLDGLGVLEKIGATAISKRPLFIILSAVGQDKITQRALALGA EYYVVKPFDMEVLISRIRQLKNVNQPNVIRQDGLSGEVKSSYHPPQPKNLEAEVTNIMH EIGVPAHIKGYQYLRDAIIMVVKDLDVINSITKQLYPTIAKEYNTTPSRVERAIRHAIE VAWSRGQIDTIDSLFGYTINVGKGKPTNSEFIAMVADKLRLEMKMAT"
This page is informational only.