Basic Vector Information
- Vector Name:
- pEBM121
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7614 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Lynd LR.
- Promoter:
- URA3
pEBM121 vector Vector Map
pEBM121 vector Sequence
LOCUS V007672 7614 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007672 VERSION V007672 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7614) AUTHORS Lynd LR. TITLE Identification of sporulation histidine kinases in C. thermocellum JOURNAL Unpublished REFERENCE 2 (bases 1 to 7614) AUTHORS Mearls EB. TITLE Direct Submission JOURNAL Submitted (06-APR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 7614) TITLE Direct Submission REFERENCE 4 (bases 1 to 7614) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-APR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7614 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 97..344 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(592..1180) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1354..2211) /label="AmpR" /note="beta-lactamase" CDS complement(2310..3110) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(3111..3331) /label="URA3 promoter" misc_feature 3359..3862 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" CDS complement(4094..5095) /label="repB" /note="RepB replication protein" regulatory 5581..6228 /gene="gapD" /regulatory_class="promoter" gene 5581..6228 /gene="gapD" /label="gapD" CDS 6229..6876 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 6895..7614 /codon_start=1 /product="histidine kinase" /label="histidine kinase" /note="from Clostridium thermocellum Clo1313_0268" /protein_id="AGO62089.1" /translation="MQASENIISFENTYIIKHNSVGASPKMIAAEELMAAAIHDLKNPL ASIRGLGQLGMLTSSSKRERSYFERIIKQVDSLNTSVIDLLSVFKPERSVKAKPSLIVK EVLDEFRAACDINNIKLIFKSEYEGEINLHIKVFKRAVENLVRNAVQILPDGGKIEIHT YEDENNFIMSINDNGPGIPDDMKESVFQPFFYQRKDGTGLGLFMVQHAITEVHGGKIWF NSKLGKGTTFYISLPKN"
This page is informational only.