Basic Vector Information
- Vector Name:
- pEBM113
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9485 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Mearls EB, Olson DG, Herring CD, Lynd LR.
- Promoter:
- URA3
pEBM113 vector Map
pEBM113 vector Sequence
LOCUS V007676 9485 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007676 VERSION V007676 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9485) AUTHORS Mearls EB, Olson DG, Herring CD, Lynd LR. TITLE Development of a regulatable plasmid-based gene expression system for Clostridium thermocellum JOURNAL Appl. Microbiol. Biotechnol. 99 (18), 7589-7599 (2015) PUBMED 25994254 REFERENCE 2 (bases 1 to 9485) AUTHORS Argyros A, Mearls EB. TITLE Direct Submission JOURNAL Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9485) TITLE Direct Submission REFERENCE 4 (bases 1 to 9485) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Microbiol. Biotechnol."; date: "2015"; volume: "99"; issue: "18"; pages: "7589-7599" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9485 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 57..304 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(552..1140) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1314..2171) /label="AmpR" /note="beta-lactamase" CDS complement(2270..3070) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(3071..3291) /label="URA3 promoter" misc_feature 3319..3822 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" CDS complement(4054..5055) /label="repB" /note="RepB replication protein" regulatory 5541..6188 /gene="gapD" /regulatory_class="promoter" gene 5541..6188 /gene="gapD" /label="gapD" CDS 6189..6836 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory 7417..7456 /regulatory_class="terminator" regulatory 7464..7502 /gene="celC" /regulatory_class="promoter" gene 7464..7502 /gene="celC" /label="celC" CDS 7626..8663 /codon_start=1 /gene="glyR3" /product="GlyR3" /label="glyR3" /note="repressor" /protein_id="AGT95728.1" /translation="MTSEEIAKLCGVSRATVSRVINNSPNVKEETRQKILAVIKEKNYV PIAPARRLAGIDSNIIGLFVLDIDISESKSRVSESTYFSRLINLIIDQANNFGFQVLVS IITSQKQLSEIRNLFMSRTIFSGIFIGAFNDEIQLDDDIIMQHPTIIIDRQSERMVKKP NRLVVNLDNFEGAYNATQFLIKLGHTRIGHISGDLRKLSGIERYEGYKKALEDAGLGFD KNLVREGNFLDDSGYRLAREILKENVTAIFCANDVMAISAIKAIKETGLSVPDDISVIG FDNTAIGNYIMPALTTVNAPLEHIAEACIESLKYFCEHKHFKQKEIRVKTDLIIRDSTK RALEF" gene 7626..8663 /gene="glyR3" /label="glyR3" CDS 8676..9485 /codon_start=1 /gene="spo0A" /product="Spo0A" /label="spo0A" /note="sporulation response regulator A" /protein_id="AGT95729.1" /translation="MTSNKIRVVIADDNREFGDILYEYLNNQEDIEVVGVARDGIEAYE LIVEKLPDIAILDIIMPHLDGLGVLEKIGATAISKRPLFIILSAVGQDKITQRALALGA EYYVVKPFDMEVLISRIRQLKNVNQPNVIRQDGLSGEVKSSYHPPQPKNLEAEVTNIMH EIGVPAHIKGYQYLRDAIIMVVKDLDVINSITKQLYPTIAKEYNTTPSRVERAIRHAIE VAWSRGQIDTIDSLFGYTINVGKGKPTNSEFIAMVADKLRLEMKMAT" gene 8676..9485 /gene="spo0A" /label="spo0A"
This page is informational only.