Basic Vector Information
- Vector Name:
- pEBM109
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9103 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Mearls EB, Olson DG, Herring CD, Lynd LR.
- Promoter:
- URA3
pEBM109 vector Map
pEBM109 vector Sequence
LOCUS V007677 9103 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007677 VERSION V007677 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9103) AUTHORS Mearls EB, Olson DG, Herring CD, Lynd LR. TITLE Development of a regulatable plasmid-based gene expression system for Clostridium thermocellum JOURNAL Appl. Microbiol. Biotechnol. 99 (18), 7589-7599 (2015) PUBMED 25994254 REFERENCE 2 (bases 1 to 9103) AUTHORS Argyros A, Mearls EB. TITLE Direct Submission JOURNAL Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9103) TITLE Direct Submission REFERENCE 4 (bases 1 to 9103) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Microbiol. Biotechnol."; date: "2015"; volume: "99"; issue: "18"; pages: "7589-7599" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9103 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 22..1059 /codon_start=1 /gene="glyR3" /product="GlyR3" /label="glyR3" /note="repressor" /protein_id="AGT95718.1" /translation="MTSEEIAKLCGVSRATVSRVINNSPNVKEETRQKILAVIKEKNYV PIAPARRLAGIDSNIIGLFVLDIDISESKSRVSESTYFSRLINLIIDQANNFGFQVLVS IITSQKQLSEIRNLFMSRTIFSGIFIGAFNDEIQLDDDIIMQHPTIIIDRQSERMVKKP NRLVVNLDNFEGAYNATQFLIKLGHTRIGHISGDLRKLSGIERYEGYKKALEDAGLGFD KNLVREGNFLDDSGYRLAREILKENVTAIFCANDVMAISAIKAIKETGLSVPDDISVIG FDNTAIGNYIMPALTTVNAPLEHIAEACIESLKYFCEHKHFKQKEIRVKTDLIIRDSTK RALEF" gene 22..1059 /gene="glyR3" /label="glyR3" terminator 1114..1361 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(1609..2197) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2371..3228) /label="AmpR" /note="beta-lactamase" CDS complement(3327..4127) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(4128..4348) /label="URA3 promoter" misc_feature 4376..4879 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" CDS complement(5111..6112) /label="repB" /note="RepB replication protein" CDS 7246..7893 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory 8938..8976 /gene="celC" /regulatory_class="promoter" gene 8938..8976 /gene="celC" /label="celC"
This page is informational only.