Basic Vector Information
- Vector Name:
- pEBM107
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9901 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Mearls EB, Olson DG, Herring CD, Lynd LR.
- Promoter:
- URA3
pEBM107 vector Vector Map
pEBM107 vector Sequence
LOCUS V007678 9901 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007678 VERSION V007678 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9901) AUTHORS Mearls EB, Olson DG, Herring CD, Lynd LR. TITLE Development of a regulatable plasmid based gene expression system for Clostridium thermocellum and discovery of a histidine kinase involved in sporulation JOURNAL Unpublished REFERENCE 2 (bases 1 to 9901) AUTHORS Argyros A, Mearls EB. TITLE Direct Submission JOURNAL Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9901) TITLE Direct Submission REFERENCE 4 (bases 1 to 9901) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-MAR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9901 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 49..296 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(544..1132) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1306..2163) /label="AmpR" /note="beta-lactamase" CDS complement(2262..3062) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(3063..3283) /label="URA3 promoter" misc_feature 3311..3814 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" CDS complement(4046..5047) /label="repB" /note="RepB replication protein" regulatory 5533..6180 /gene="gapD" /regulatory_class="promoter" gene 5533..6180 /gene="gapD" /label="gapD" CDS 6181..6828 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory 7808..7895 /regulatory_class="terminator" regulatory 7855..7893 /gene="celC" /regulatory_class="promoter" gene 7855..7893 /gene="celC" /label="celC" CDS 8023..8832 /codon_start=1 /gene="spo0A" /product="Spo0A" /label="spo0A" /note="sporulation response regulator A" /protein_id="AGT95724.1" /translation="MTSNKIRVVIADDNREFGDILYEYLNNQEDIEVVGVARDGIEAYE LIVEKLPDIAILDIIMPHLDGLGVLEKIGATAISKRPLFIILSAVGQDKITQRALALGA EYYVVKPFDMEVLISRIRQLKNVNQPNVIRQDGLSGEVKSSYHPPQPKNLEAEVTNIMH EIGVPAHIKGYQYLRDAIIMVVKDLDVINSITKQLYPTIAKEYNTTPSRVERAIRHAIE VAWSRGQIDTIDSLFGYTINVGKGKPTNSEFIAMVADKLRLEMKMAT" gene 8023..8832 /gene="spo0A" /label="spo0A" CDS 8859..9896 /codon_start=1 /gene="glyr3" /product="GlyR3" /label="glyr3" /note="repressor" /protein_id="AGT95725.1" /translation="MTSEEIAKLCGVSRATVSRVINNSPNVKEETRQKILAVIKEKNYV PIAPARRLAGIDSNIIGLFVLDIDISESKSRVSESTYFSRLINLIIDQANNFGFQVLVS IITSQKQLSEIRNLFMSRTIFSGIFIGAFNDEIQLDDDIIMQHPTIIIDRQSERMVKKP NRLVVNLDNFEGAYNATQFLIKLGHTRIGHISGDLRKLSGIERYEGYKKALEDAGLGFD KNLVREGNFLDDSGYRLAREILKENVTAIFCANDVMAISAIKAIKETGLSVPDDISVIG FDNTAIGNYIMPALTTVNAPLEHIAEACIESLKYFCEHKHFKQKEIRVKTDLIIRDSTK RALEF" gene 8859..9896 /gene="glyr3" /label="glyr3"
This page is informational only.