Basic Vector Information
- Vector Name:
- pEBM103
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11541 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Lynd LR.
- Promoter:
- URA3
pEBM103 vector Map
pEBM103 vector Sequence
LOCUS V007679 11541 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007679 VERSION V007679 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 11541) AUTHORS Lynd LR. TITLE Identification of sporulation histidine kinases in C. thermocellum JOURNAL Unpublished REFERENCE 2 (bases 1 to 11541) AUTHORS Mearls EB. TITLE Direct Submission JOURNAL Submitted (06-APR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 11541) TITLE Direct Submission REFERENCE 4 (bases 1 to 11541) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-APR-2013) Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11541 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 47..294 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(542..1130) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1217..1795) /codon_start=1 /gene="tdk" /product="tdk" /label="tdk" /protein_id="AGO62074.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(1217..1795) /gene="tdk" /label="tdk" regulatory 1796..2416 /gene="cbp" /regulatory_class="promoter" gene 1796..2416 /gene="cbp" /label="cbp" CDS complement(2495..3496) /label="repB" /note="RepB replication protein" CDS complement(4057..4914) /label="AmpR" /note="beta-lactamase" CDS complement(5013..5813) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(5814..6034) /label="URA3 promoter" misc_feature 6062..6565 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" misc_recomb 6570..6728 misc_recomb 7855..8881 regulatory 8897..9544 /gene="gapD" /regulatory_class="promoter" gene 8897..9544 /gene="gapD" /label="gapD" CDS 9545..10192 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 10213..10758 /codon_start=1 /gene="hpt" /product="hpt" /label="hpt" /note="hypoxanthine phosphoribosyltransferase" /protein_id="AGO62077.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 10213..10758 /gene="hpt" /label="hpt" misc_recomb 10822..11541
This page is informational only.