Basic Vector Information
- Vector Name:
- pEBDuet28A
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5258 bp
- Type:
- Expression vector
- Replication origin:
- RSF ori
- Source/Author:
- Buchinger E, Aachmann FL, Aranko AS, Valla S, Skjak-Braek G, Iwai H, Wimmer R.
pEBDuet28A vector Vector Map
pEBDuet28A vector Sequence
LOCUS 40924_16565 5258 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pEBDuet28A, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5258) AUTHORS Buchinger E, Aachmann FL, Aranko AS, Valla S, Skjak-Braek G, Iwai H, Wimmer R. TITLE Use of protein trans-splicing to produce active and segmentally (2)H, (15)N labeled mannuronan C5-epimerase AlgE4 JOURNAL Protein Sci. 19 (8), 1534-1543 (2010) PUBMED 20552686 REFERENCE 2 (bases 1 to 5258) AUTHORS Buchinger E, Aachmann FL, Aranko S, Valla S, Sjaak-Braek G, Iwai H, Wimmer R. TITLE Direct Submission JOURNAL Submitted (23-MAR-2010) Aalborg University, Sohngaardsholmsvej 49, Aalborg 9000, Denmark REFERENCE 3 (bases 1 to 5258) TITLE Direct Submission REFERENCE 4 (bases 1 to 5258) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Protein Sci."; date: "2010"; volume: "19"; issue: "8"; pages: "1534-1543" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-MAR-2010) Aalborg University, Sohngaardsholmsvej 49, Aalborg 9000, Denmark" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5258 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 30..48 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 49..73 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 88..110 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 129..146 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 147..167 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQS" promoter 1689..1707 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1708..1732 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1841..1885 /codon_start=1 /label=S-Tag /note="affinity and epitope tag derived from pancreatic ribonuclease A" /translation="KETAAAKFERQHMDS" terminator 1937..1984 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(2217..3029) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" promoter complement(3030..3121) /label=AmpR promoter rep_origin complement(3137..3886) /direction=LEFT /label=RSF ori /note="Plasmids containing the RSF 1030 origin of replication can be propagated in E. coli cells that contain additional plasmids with compatible origins." protein_bind complement(4048..4069) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(4085..5164) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(5165..5242) /label=lacI promoter
This page is informational only.