Basic Vector Information
- Vector Name:
- pEamTA
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4451 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Reisinger C, Kern A, Fesko K, Schwab H.
pEamTA vector Map
pEamTA vector Sequence
LOCUS 40924_16455 4451 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pEamTA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4451) AUTHORS Reisinger C, Kern A, Fesko K, Schwab H. TITLE An efficient plasmid vector for expression cloning of large numbers of PCR fragments in Escherichia coli JOURNAL Appl. Microbiol. Biotechnol. 77 (1), 241-244 (2007) PUBMED 17786428 REFERENCE 2 (bases 1 to 4451) AUTHORS Reisinger C, Kern A, Fesko K, Schwab H. TITLE Direct Submission JOURNAL Submitted (19-APR-2007) 1 Research Centre Applied Biocatalysis, Petersgasse 14/4, Graz, Styria A-8010, Austria REFERENCE 3 (bases 1 to 4451) TITLE Direct Submission REFERENCE 4 (bases 1 to 4451) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Microbiol. Biotechnol."; date: "2007"; volume: "77"; issue: "1"; pages: "241-244" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-APR-2007) 1 Research Centre Applied Biocatalysis, Petersgasse 14/4, Graz, Styria A-8010, Austria" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4451 /mol_type="other DNA" /organism="synthetic DNA construct" RBS 40..62 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" misc_feature 69 /label=single 3'-T overhang in linearized vector /note="single 3'-T overhang in linearized vector" misc_feature 517 /label=single 3'-T overhang in linearized vector /note="single 3'-T overhang in linearized vector" terminator 746..832 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 924..951 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 971..1062 /label=AmpR promoter CDS 1063..1920 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2094..2682 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2996..4075) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTSKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4076..4153) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 4383..4411 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 4419..4435 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.