Basic Vector Information
- Vector Name:
- pE6n
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3030 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Dubin MJ, Bowler C, Benvenuto G.
pE6n vector Map
pE6n vector Sequence
LOCUS 40924_16445 3030 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pE6n, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3030) AUTHORS Dubin MJ, Bowler C, Benvenuto G. TITLE A modified Gateway cloning strategy for overexpressing tagged proteins in plants JOURNAL Plant Methods 4, 3 (2008) PUBMED 18211686 REFERENCE 2 (bases 1 to 3030) AUTHORS Dubin MJ, Bowler C, Benvenuto G. TITLE Direct Submission JOURNAL Submitted (11-DEC-2007) Cell Signalling Laboratory, Stazione Zoologica Anton Dohrn, Villa Comunale, Naples 80121, Italy REFERENCE 3 (bases 1 to 3030) TITLE Direct Submission REFERENCE 4 (bases 1 to 3030) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Methods 4, 3 (2008)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-DEC-2007) Cell Signalling Laboratory, Stazione Zoologica Anton Dohrn, Villa Comunale, Naples 80121, Italy" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3030 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 103..189 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 281..308 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind 358..457 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" CDS 481..1197 /codon_start=1 /label=EYFP /note="enhanced YFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature 1201..1232 /label=multiple cloning site /note="multiple cloning site" protein_bind complement(1259..1358) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 1481..2287 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVSLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2380..2968 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.