Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V007700 | pE6c | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pE6c
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3023 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Dubin MJ, Bowler C, Benvenuto G.
pE6c vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pE6c vector Sequence
LOCUS 40924_16440 3023 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pE6c, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3023) AUTHORS Dubin MJ, Bowler C, Benvenuto G. TITLE A modified Gateway cloning strategy for overexpressing tagged proteins in plants JOURNAL Plant Methods 4, 3 (2008) PUBMED 18211686 REFERENCE 2 (bases 1 to 3023) AUTHORS Dubin MJ, Bowler C, Benvenuto G. TITLE Direct Submission JOURNAL Submitted (11-DEC-2007) Cell Signalling Laboratory, Stazione Zoologica Anton Dohrn, Villa Comunale, Naples 80121, Italy REFERENCE 3 (bases 1 to 3023) TITLE Direct Submission REFERENCE 4 (bases 1 to 3023) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Methods 4, 3 (2008)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-DEC-2007) Cell Signalling Laboratory, Stazione Zoologica Anton Dohrn, Villa Comunale, Naples 80121, Italy" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3023 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 103..189 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 281..308 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" protein_bind 358..457 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" misc_feature 482..513 /label=multiple cloning site /note="multiple cloning site" CDS 518..1234 /codon_start=1 /label=EYFP /note="enhanced YFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" protein_bind complement(1252..1351) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 1474..2280 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVSLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2373..2961 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"