Basic Vector Information
- Vector Name:
- pDuExP (pDuExAn6)
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7315 bp
- Type:
- Plant expression vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Fujikawa Y, Kato N.
- Promoter:
- CaMV35S(long)
pDuExP (pDuExAn6) vector Vector Map
pDuExP (pDuExAn6) vector Sequence
LOCUS 40924_16280 7315 bp DNA circular SYN 17-DEC-2018
DEFINITION Plant expression vector pDuExP (pDuExAn6), complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7315)
AUTHORS Fujikawa Y, Kato N.
TITLE Split luciferase complementation assay to study protein-protein
interactions in Arabidopsis protoplasts
JOURNAL Plant J. 52 (1), 185-195 (2007)
PUBMED 17662028
REFERENCE 2 (bases 1 to 7315)
AUTHORS Kato N.
TITLE Direct Submission
JOURNAL Submitted (19-APR-2007) Dapartment of Biological Sciences, Louisiana
State University, 226 Life Sciences Building, Baton Rouge, LA
70803-1715, USA
REFERENCE 3 (bases 1 to 7315)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7315)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J.";
date: "2007"; volume: "52"; issue: "1"; pages: "185-195"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(19-APR-2007) Dapartment of Biological Sciences, Louisiana State
University, 226 Life Sciences Building, Baton Rouge, LA 70803-1715,
USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7315
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 9..26
/label=6xHis
/note="6xHis affinity tag"
CDS 27..713
/codon_start=1
/product="NhRluc"
/label=NhRluc
/note="N-terminal fragment of the Renilla luciferase
protein"
/protein_id="ABU49619.1"
/translation="MASKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAEN
AVIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAW
FELLNLPKKIIFVGHDWGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDI
ALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPRE
IPLVKGG"
misc_feature 714..744
/note="2x(Gly-Gly-Gly-Gly-Ser); linker"
protein_bind 750..874
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 1021..1123
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 1124..1780
/label=CmR
/note="chloramphenicol acetyltransferase"
CDS 2125..2427
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(2471..2595)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
terminator 2619..2871
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
primer_bind complement(2880..2896)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(3290..3308)
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
primer_bind complement(3326..3342)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3350..3366)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3374..3404)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3419..3440)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(3728..4316)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4490..5347)
/label=AmpR
/note="beta-lactamase"
promoter complement(5348..5452)
/label=AmpR promoter
rep_origin complement(5530..5985)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 6126..6142
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 6149..6167
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
regulatory 6198..6207
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
promoter 6221..6239
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
protein_bind complement(6305..6338)
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
promoter 6858..7203
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
misc_feature 7232..7287
/label=TMV Omega
/note="translational enhancer from the tobacco mosaic virus
5'-leader sequence (Gallie et al., 1988)"
This page is informational only.