pDuExB (pDuExDc6) vector (V007727)

LOCUS       40924_16270        8358 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Plant expression vector pDuExB (pDuExDc6), complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8358)
  AUTHORS   Fujikawa Y, Kato N.
  TITLE     Split luciferase complementation assay to study protein-protein 
            interactions in Arabidopsis protoplasts
  JOURNAL   Plant J. 52 (1), 185-195 (2007)
  PUBMED    17662028
REFERENCE   2  (bases 1 to 8358)
  AUTHORS   Kato N.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-APR-2007) Dapartment of Biological Sciences, Louisiana
            State University, 226 Life Sciences Building, Baton Rouge, LA 
            70803-1715, USA
REFERENCE   3  (bases 1 to 8358)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8358)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant J."; 
            date: "2007"; volume: "52"; issue: "1"; pages: "185-195"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (19-APR-2007) Dapartment of Biological Sciences, Louisiana State 
            University, 226 Life Sciences Building, Baton Rouge, LA 70803-1715, 
            USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8358
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    6..36
                     /note="2x(Gly-Gly-Gly-Gly-Ser); linker"
     CDS             36..281
                     /codon_start=1
                     /product="ChRluc"
                     /label=ChRluc
                     /note="C-terminal fragment of the Renilla luciferase
                     protein"
                     /protein_id="ABU49623.1"
                     /translation="KPDVVQIVRNYNAYLRASDDLPKMFIESDPGFFSNAIVEGAKKFP
                     NTEFVKVKGLHFSQEDAPDEMGKYIKSFVERVLKNEQ"
     CDS             282..299
                     /label=tetracysteine tag
                     /note="tetracysteine peptide that binds biarsenical
                     labeling reagents"
     terminator      324..576
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(585..601)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(909..1565)
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     misc_recomb     1594..1627
                     /label=loxP
                     /note="loxP"
     protein_bind    1594..1627
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     promoter        1642..2087
                     /label=sacB promoter
                     /note="sacB promoter and control region"
     CDS             2088..3506
                     /label=SacB
                     /note="secreted levansucrase that renders bacterial growth 
                     sensitive to sucrose"
     promoter        3577..3681
                     /label=AmpR promoter
     CDS             3682..4539
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      4713..5301
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     primer_bind     5418..5434
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        5442..5460
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     protein_bind    complement(5526..5559)
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     promoter        6079..6424
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     misc_feature    6436..6491
                     /label=TMV Omega
                     /note="translational enhancer from the tobacco mosaic virus
                     5'-leader sequence (Gallie et al., 1988)"
     protein_bind    6505..6629
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        6776..6878
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             6879..7535
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             7880..8182
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(8226..8350)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"