Basic Vector Information
- Vector Name:
- pDSW1728
- Antibiotic Resistance:
- Tetracycline
- Length:
- 7913 bp
- Type:
- Clostridium difficile shuttle vector
- Replication origin:
- ori
- Source/Author:
- Ransom EM, Ellermeier CD, Weiss DS.
pDSW1728 vector Vector Map
pDSW1728 vector Sequence
LOCUS V007836 7913 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007836 VERSION V007836 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7913) AUTHORS Ransom EM, Ellermeier CD, Weiss DS. TITLE Use of mCherry Red fluorescent protein for studies of protein localization and gene expression in Clostridium difficile JOURNAL Appl. Environ. Microbiol. 81 (5), 1652-1660 (2015) PUBMED 25527559 REFERENCE 2 (bases 1 to 7913) AUTHORS Ransom EM, Ellermeier CD, Weiss DS. TITLE Direct Submission JOURNAL Submitted (06-AUG-2015) Microbiology, The University of Iowa, 51 Newton Rd, Iowa City, IA 52242, USA REFERENCE 3 (bases 1 to 7913) TITLE Direct Submission REFERENCE 4 (bases 1 to 7913) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2015"; volume: "81"; issue: "5"; pages: "1652-1660" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-AUG-2015) Microbiology, The University of Iowa, 51 Newton Rd, Iowa City, IA 52242, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7913 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(58..681) /label="TetR" /note="tetracycline repressor TetR" protein_bind 788..806 /label="tet operator" /note="bacterial operator O1 for the tetR and tetA genes" CDS 873..1580 /label="mCherry" /note="monomeric derivative of DsRed fluorescent protein (Shaner et al., 2004)" CDS complement(1932..2300) /label="traJ" /note="oriT-recognizing protein" oriT complement(2333..2442) /direction=LEFT /label="oriT" /note="incP origin of transfer" CDS complement(2821..3441) /gene="catP" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Clostridium perfringens. Accession#: P26826" rep_origin complement(3804..4392) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5185..6822) /codon_start=1 /gene="repA" /product="RepA" /label="repA" /note="plasmid replication; derived from Clostridium difficile" /protein_id="AMA07799.1" /translation="MEQLDSKYKLKKFLMAVFRDGIGQGNNLIDNEYVRVFQNNKSNSK QLELGEEFKEYSKTTFFKNIDDIVEFTFAKNIYYENTFFNLCTTDGKAGTNENLINRYA LGFDFDKKELGQGFNYKDIINLFTKIGLHYHILVDSGNGFHVYVLINKTNNIKLVSEVT NTLINKLGADKQANLSTQVLRVPYTYNIKNTTKQVKIIHQDKNIYRYDIEKLAKKYCKD VKTVGNTNTKYILDSKLPNCIVDILKNGSKDGHKNLDLQKIVVTLRLRNKSLSQVISVA REWNYISQNSLSNSELEYQVKYMYEKLKTVNFGCTGCEFNSDCWNKIESDFIYSDEDTL FNMPHKHSKDLKYKNRKGVKIMTGNQLFIYNVLLNNKDRELNIDDIMELITYKRKKKVK NIVMSEKTLRETLKELQHNDYITKTKGVTKLGIKDTYNVKEVRCNIDKQYTISYFVTMA VIWGIISTEELRLYTHMRYKQDLLVKDDKIKGNILRINQEELAKDLGVTQQRISNMIES LLDTKILDVWETKINDRGFMYYTYRLNK" gene complement(5185..6822) /gene="repA" /label="repA" CDS complement(7097..7609) /codon_start=1 /gene="orfB" /product="OrfB" /label="orfB" /protein_id="AMA07800.1" /translation="MRARSSKWRYHIRTNNKSICCNIKNFIHNLELFYKMELKLSDNII NDKLYYSNIAEFEEFETLEKAREVESTIISQYQFLDSINHMLKQKIILLSNKDSVLNIT KNGNTNYLKVKNKYIEKHKNKPIMRYHINCQFNTDGSVKSITQEFEPILELNKKNTLSR PSRVFLK" gene complement(7097..7609) /gene="orfB" /label="orfB"
This page is informational only.