Basic Vector Information
- Vector Name:
- pDSG404
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5975 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Glass DS, Riedel-Kruse IH.
pDSG404 vector Map
pDSG404 vector Sequence
LOCUS 40924_15530 5975 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDSG404, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5975) AUTHORS Glass DS, Riedel-Kruse IH. TITLE A synthetic bacterial cell-cell adhesion toolbox for programming multicellular morphologies and patterns JOURNAL Cell (2018) In press REFERENCE 2 (bases 1 to 5975) AUTHORS Glass DS. TITLE Direct Submission JOURNAL Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 5975) TITLE Direct Submission REFERENCE 4 (bases 1 to 5975) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5975 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..36 /label=pLacIQ (BBa_I4032, 1nt deletion) /note="pLacIQ (BBa_I4032, 1nt deletion)" misc_feature 45..56 /label=RBS (BBa_B0034) /note="RBS (BBa_B0034)" misc_feature 45..56 /label=BBa_J04500(1) /note="BBa_J04500(1)" RBS 45..56 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 63..683 /label=TetR /note="tetracycline repressor TetR" terminator 706..777 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 793..820 /label=T7Te terminator /note="phage T7 early transcription terminator" protein_bind 835..853 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" protein_bind 860..878 /gene="tetO" /label=tet operator /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O2 for the tetR and tetA genes" misc_feature 897..908 /label=RBS (BBa_B0034)(1) /note="RBS (BBa_B0034)(1)" misc_feature 897..908 /label=BBa_J04500 /note="BBa_J04500" RBS 897..908 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 915..3224 /codon_start=1 /product="mutated Neae" /label=mutated Neae /note="removed restriction sites" /protein_id="AXC07768.1" /translation="MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYF KLGSDSKLLTHDSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKA APGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKAL NYAAQQAASLGSQLQSRSLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNN FDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQD FSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPS YPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNEN DLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNI PHDINGTEHSTQKIQLIVKSKYGLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAY VQGGSNIYKVTARAYDRNGNSSNNVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNAD TITYTATVKKNGVAQANVPVSFNIVSGTATLGANSAKTDANGKATVTLKSSTPGQVVVS AKTAEMTSALNASAVIFFDGATRQVQLQESGGGLVQPGGSLRLSCAVSGNIFSNNAMGW YRQAPGKERKLVAAVSSGGSTYYADSVKGRFTISRSNTKNTLYLQMNDLKPEDTGVYQC RQGSTLGQGTQVTVSS" CDS 2889..3224 /codon_start=1 /product="N8-7_antiP53TA-R3P28" /label=N8-7_antiP53TA-R3P28 /protein_id="AXC07766.1" /translation="QVQLQESGGGLVQPGGSLRLSCAVSGNIFSNNAMGWYRQAPGKER KLVAAVSSGGSTYYADSVKGRFTISRSNTKNTLYLQMNDLKPEDTGVYQCRQGSTLGQG TQVTVSS" misc_feature 3222..3227 /label=stop codons /note="stop codons" misc_feature 3228..3248 /label=BioBrick suffix /note="universal suffix for all parts" terminator 3249..3306 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." misc_feature complement(3384..3401) /label=VR primer site /note="VR primer site" CDS complement(3467..4279) /label=KanR /note="aminoglycoside phosphotransferase" rep_origin complement(4874..5418) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 5836..5856 /label=VF2 primer site /note="VF2 primer site" terminator complement(5908..5951) /label=bacterial terminator /note="putative bacterial transcription terminator" misc_feature 5954..5975 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'"
This page is informational only.