Basic Vector Information
- Vector Name:
- pDSG372
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6014 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Glass DS, Riedel-Kruse IH.
pDSG372 vector Map
pDSG372 vector Sequence
LOCUS 40924_15370 6014 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDSG372, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6014) AUTHORS Glass DS, Riedel-Kruse IH. TITLE A synthetic bacterial cell-cell adhesion toolbox for programming multicellular morphologies and patterns JOURNAL Cell (2018) In press REFERENCE 2 (bases 1 to 6014) AUTHORS Glass DS. TITLE Direct Submission JOURNAL Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 6014) TITLE Direct Submission REFERENCE 4 (bases 1 to 6014) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6014 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..36 /label=pLacIQ (BBa_I4032, 1nt deletion) /note="pLacIQ (BBa_I4032, 1nt deletion)" misc_feature 45..56 /label=RBS (BBa_B0034) /note="RBS (BBa_B0034)" misc_feature 45..56 /label=BBa_J04500(1) /note="BBa_J04500(1)" RBS 45..56 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 63..683 /label=TetR /note="tetracycline repressor TetR" terminator 706..777 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 793..820 /label=T7Te terminator /note="phage T7 early transcription terminator" protein_bind 835..853 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" protein_bind 860..878 /gene="tetO" /label=tet operator /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O2 for the tetR and tetA genes" misc_feature 897..908 /label=RBS (BBa_B0034)(1) /note="RBS (BBa_B0034)(1)" misc_feature 897..908 /label=BBa_J04500 /note="BBa_J04500" RBS 897..908 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 915..3263 /codon_start=1 /product="mutated Neae" /label=mutated Neae /note="removed restriction sites" /protein_id="AXC07720.1" /translation="MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYF KLGSDSKLLTHDSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKA APGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKAL NYAAQQAASLGSQLQSRSLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNN FDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQD FSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPS YPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNEN DLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNI PHDINGTEHSTQKIQLIVKSKYGLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAY VQGGSNIYKVTARAYDRNGNSSNNVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNAD TITYTATVKKNGVAQANVPVSFNIVSGTATLGANSAKTDANGKATVTLKSSTPGQVVVS AKTAEMTSALNASAVIFFDGATRQVQLQESGGGLVQAGGSLRLSCAASGLTFDDYAIGW FRQAPGKEREGVSCIRRSDGMTYYADSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYY CAASDYSDYGLRPYEYDYWGQGTQVTVSS" CDS 2889..3263 /codon_start=1 /product="N3-1_antiAkt3PH-3AKH13" /label=N3-1_antiAkt3PH-3AKH13 /protein_id="AXC07718.1" /translation="QVQLQESGGGLVQAGGSLRLSCAASGLTFDDYAIGWFRQAPGKER EGVSCIRRSDGMTYYADSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYYCAASDYSDY GLRPYEYDYWGQGTQVTVSS" misc_feature 3261..3266 /label=stop codons /note="stop codons" misc_feature 3267..3287 /label=BioBrick suffix /note="universal suffix for all parts" terminator 3288..3345 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." misc_feature complement(3423..3440) /label=VR primer site /note="VR primer site" CDS complement(3506..4318) /label=KanR /note="aminoglycoside phosphotransferase" rep_origin complement(4913..5457) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 5875..5895 /label=VF2 primer site /note="VF2 primer site" terminator complement(5947..5990) /label=bacterial terminator /note="putative bacterial transcription terminator" misc_feature 5993..6014 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'"
This page is informational only.