Basic Vector Information
- Vector Name:
- pDSG312
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6342 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Glass DS, Riedel-Kruse IH.
- Promoter:
- araBAD
pDSG312 vector Vector Map
pDSG312 vector Sequence
LOCUS 40924_15250 6342 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDSG312, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6342) AUTHORS Glass DS, Riedel-Kruse IH. TITLE A synthetic bacterial cell-cell adhesion toolbox for programming multicellular morphologies and patterns JOURNAL Cell (2018) In press REFERENCE 2 (bases 1 to 6342) AUTHORS Glass DS. TITLE Direct Submission JOURNAL Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 6342) TITLE Direct Submission REFERENCE 4 (bases 1 to 6342) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6342 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(4..879) /label=araC /note="L-arabinose regulatory protein" promoter 906..1190 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)" misc_feature 1219..1230 /label=RBS (BBa_B0034) /note="RBS (BBa_B0034)" misc_feature 1219..1230 /label=BBa_J04500 /note="BBa_J04500" RBS 1219..1230 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 1237..3591 /codon_start=1 /product="mutated Neae" /label=mutated Neae /note="removed restriction sites" /protein_id="AXC07666.1" /translation="MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYF KLGSDSKLLTHDSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKA APGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKAL NYAAQQAASLGSQLQSRSLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNN FDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQD FSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPS YPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNEN DLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNI PHDINGTEHSTQKIQLIVKSKYGLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAY VQGGSNIYKVTARAYDRNGNSSNNVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNAD TITYTATVKKNGVAQANVPVSFNIVSGTATLGANSAKTDANGKATVTLKSSTPGQVVVS AKTAEMTSALNASAVIFFDGATRQGQLVESGGGSVQAGGSLRLSCAASGIDSSSYCMGW FRQRPGKEREGVARINGLGGVKTAYADSVKDRFTISRDNAENTVYLQMNSLKPEDTAIY YCAAKFSPGYCGGSWSNFGYWGQGTQVTVSS" CDS 3211..3591 /codon_start=1 /product="EPEA tag nanobody protein" /label=EPEA tag nanobody protein /protein_id="AXC07668.1" /translation="QGQLVESGGGSVQAGGSLRLSCAASGIDSSSYCMGWFRQRPGKER EGVARINGLGGVKTAYADSVKDRFTISRDNAENTVYLQMNSLKPEDTAIYYCAAKFSPG YCGGSWSNFGYWGQGTQVTVSS" misc_feature 3589..3594 /label=stop codons /note="stop codons" misc_feature 3595..3615 /label=BioBrick suffix /note="universal suffix for all parts" terminator 3616..3673 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." misc_feature complement(3751..3768) /label=VR primer site /note="VR primer site" CDS complement(3834..4646) /label=KanR /note="aminoglycoside phosphotransferase" rep_origin complement(5241..5785) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 6203..6223 /label=VF2 primer site /note="VF2 primer site" terminator complement(6275..6318) /label=bacterial terminator /note="putative bacterial transcription terminator" misc_feature 6321..6342 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'"
This page is informational only.