Basic Vector Information
- Vector Name:
- pDSG290
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6701 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Glass DS, Riedel-Kruse IH.
pDSG290 vector Map
pDSG290 vector Sequence
LOCUS 40924_15235 6701 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDSG290, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6701) AUTHORS Glass DS, Riedel-Kruse IH. TITLE A synthetic bacterial cell-cell adhesion toolbox for programming multicellular morphologies and patterns JOURNAL Cell (2018) In press REFERENCE 2 (bases 1 to 6701) AUTHORS Glass DS. TITLE Direct Submission JOURNAL Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 6701) TITLE Direct Submission REFERENCE 4 (bases 1 to 6701) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6701 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..36 /label=pLacIQ (BBa_I4032, 1nt deletion) /note="pLacIQ (BBa_I4032, 1nt deletion)" misc_feature 45..56 /label=RBS (BBa_B0034)(1) /note="RBS (BBa_B0034)(1)" misc_feature 45..56 /label=BBa_J04500(1) /note="BBa_J04500(1)" RBS 45..56 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 63..683 /label=TetR /note="tetracycline repressor TetR" terminator 706..777 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 793..820 /label=T7Te terminator /note="phage T7 early transcription terminator" protein_bind 835..853 /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes" protein_bind 860..878 /gene="tetO" /label=tet operator /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O2 for the tetR and tetA genes" misc_feature 897..908 /label=RBS (BBa_B0034) /note="RBS (BBa_B0034)" misc_feature 897..908 /label=BBa_J04500 /note="BBa_J04500" RBS 897..908 /note="strong bacterial ribosome binding site (Elowitz and Leibler, 2000)" CDS 915..3224 /codon_start=1 /product="mutated Neae" /label=mutated Neae /note="removed restriction sites" /protein_id="AXC07642.1" /translation="MITHGCYTRTRHKHKLKKTLIMLSAGLGLFFYVNQNSFANGENYF KLGSDSKLLTHDSYQNRLFYTLKTGETVADLSKSQDINLSTIWSLNKHLYSSESEMMKA APGQQIILPLKKLPFEYSALPLLGSAPLVAAGGVAGHTNKLTKMSPDVTKSNMTDDKAL NYAAQQAASLGSQLQSRSLNGDYAKDTALGIAGNQASSQLQAWLQHYGTAEVNLQSGNN FDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQD FSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPS YPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNEN DLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYKKQDILSLNI PHDINGTEHSTQKIQLIVKSKYGLDRIVWDDSALRSQGGQIQHSGSQSAQDYQAILPAY VQGGSNIYKVTARAYDRNGNSSNNVQLTITVLSNGQVVDQVGVTDFTADKTSAKADNAD TITYTATVKKNGVAQANVPVSFNIVSGTATLGANSAKTDANGKATVTLKSSTPGQVVVS AKTAEMTSALNASAVIFFDGATRQVQLQESGGGSVRPGESLRLSCIAAGTLFSGKAVGW YRQAPGKDRELVAALSSGRETYYIGPVKGRFIISRDDNKDTLYLQMNNLKLEDTAIYTC RLGLHWGQGTQVTVSS" CDS 2889..3224 /codon_start=1 /product="human P53 transactivation domain nanobody R4P43" /label=human P53 transactivation domain nanobody R4P43 /protein_id="AXC07643.1" /translation="QVQLQESGGGSVRPGESLRLSCIAAGTLFSGKAVGWYRQAPGKDR ELVAALSSGRETYYIGPVKGRFIISRDDNKDTLYLQMNNLKLEDTAIYTCRLGLHWGQG TQVTVSS" misc_feature 3222..3227 /label=stop codons /note="stop codons" terminator complement(3247..3290) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 3331..3358 /label=T7Te terminator /note="phage T7 early transcription terminator" misc_feature 3365..3385 /label=BioBrick suffix /note="universal suffix for all parts" terminator 3386..3443 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." misc_feature complement(3521..3538) /label=VR primer site /note="VR primer site" CDS complement(3749..4696) /label=Rep101 /note="RepA protein needed for replication with the pSC101 origin" misc_feature complement(4700..4712) /label=RBS for repA /note="RBS for repA" regulatory complement(4717..4736) /label=repA promoter /note="repA promoter" /regulatory_class="promoter" rep_origin complement(4744..4966) /direction=LEFT /label=pSC101 ori /note="low-copy replication origin that requires the Rep101 protein" terminator complement(5458..5552) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(5585..6442) /label=AmpR /note="beta-lactamase" promoter complement(6443..6547) /label=AmpR promoter misc_feature 6562..6582 /label=VF2 primer site /note="VF2 primer site" terminator complement(6634..6677) /label=bacterial terminator /note="putative bacterial transcription terminator" misc_feature 6680..6701 /label=BioBrick prefix /note="BioBrick prefix for parts that do not start with 'ATG'"
This page is informational only.