Basic Vector Information
- Vector Name:
- pDSG254
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5826 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Glass DS, Riedel-Kruse IH.
pDSG254 vector Map
pDSG254 vector Sequence
LOCUS 40924_15195 5826 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDSG254, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5826) AUTHORS Glass DS, Riedel-Kruse IH. TITLE A synthetic bacterial cell-cell adhesion toolbox for programming multicellular morphologies and patterns JOURNAL Cell (2018) In press REFERENCE 2 (bases 1 to 5826) AUTHORS Glass DS. TITLE Direct Submission JOURNAL Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA REFERENCE 3 (bases 1 to 5826) TITLE Direct Submission REFERENCE 4 (bases 1 to 5826) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell (2018) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-JUN-2018) Bioengineering, Stanford University, 318 Campus Drive, Clark Center E350, Stanford, CA 94305, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5826 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 5..82 /label=lacI promoter CDS 83..1162 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 1233..1254 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1269..1299 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 1307..1323 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 1331..1347 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 1383..3350 /label=intimin N-terminus /note="intimin N-terminus" misc_feature 3351..3389 /label=E-tag /note="E-tag" CDS 3393..3407 /codon_start=1 /product="EPEA peptide protein" /label=EPEA peptide protein /note="C-terminus of alpha synuclein" /protein_id="AXC07689.1" /translation="EPEA" misc_feature 3393..3404 /label=Neae fusion /note="Neae fusion" misc_feature 3420..3446 /label=myc tag /note="myc tag" rep_origin 3545..4000 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS 4187..4843 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" rep_origin 5178..5766 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.