Basic Vector Information
- Vector Name:
- pDP28
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 7790 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Manso AS, Iannelli F, Pozzi G, Furi L, Oggioni MR.
pDP28 vector Vector Map
pDP28 vector Sequence
LOCUS V007934 7790 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007934 VERSION V007934 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7790) AUTHORS Manso AS, Iannelli F, Pozzi G, Furi L, Oggioni MR. TITLE The nucleotide sequence of the Streptococcus pneumoniae Escherichia coli shuttle vector pDP28 JOURNAL Unpublished REFERENCE 2 (bases 1 to 7790) AUTHORS Manso AS, Iannelli F, Pozzi G, Furi L, Oggioni MR. TITLE Direct Submission JOURNAL Submitted (30-JAN-2014) Department of Genetics, University of Leicester, Adrian Building, University Road, Leicester LE1 7RH, UK REFERENCE 3 (bases 1 to 7790) TITLE Direct Submission REFERENCE 4 (bases 1 to 7790) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JAN-2014) Department of Genetics, University of Leicester, Adrian Building, University Road, Leicester LE1 7RH, UK" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7790 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..2392 /note="HindIII-SalI fragment of plasmid pSMB1 in INSDC accession AF047385" rep_origin 184..201 /note="double strand replication origin of pneumococcal plasmids pDP1 and pSMB1" CDS 403..1365 /codon_start=1 /gene="rep" /product="replication protein" /label="rep" /note="REP pDP1 pSMB1" /protein_id="AHX11846.1" /translation="MEKWENQDKILLDKNKRGKDRNWRGRKLLSLKLADIFKELGYRET LIERVETCGDTLRFIRREDGSLRLYQAYFCKNKLCPMCNWRRSMKYSYQTSQIVDEAIK EQPKGRFLFLTLTVKNVPGKELNATISQLTQSFDRLFRRAKVKKNLIGFLRSVEVTHNQ EEETYHPHIHVLMMVKSSYFSGAGDNYVSQEEWGRMWEQSLKVDYVPMVDIRSVKEIGK GLKGAILETAKYPIKPIKLDVENKQVVGDLYNGLYRKRQLGYGGLFKEIRKRLQLSNVE NGDLVYTSDDNDEMSKGTKIVAIWNATKQNYFVKNKGWN" gene 403..1365 /gene="rep" /label="rep" rep_origin 2352..2392 /note="single strand replication origin of pneumococcal plasmids pDP1 and pSMB1" CDS complement(4050..4706) /label="CmR" /note="chloramphenicol acetyltransferase" promoter complement(4707..4809) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(5335..5880) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(6142..6876) /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5"
This page is informational only.