Basic Vector Information
- Vector Name:
- pDONR-A-Hyg
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5882 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Garcia-Pedrajas MD, Nadal M, Kapa LB, Perlin MH, Andrews DL, Gold SE.
pDONR-A-Hyg vector Map
pDONR-A-Hyg vector Sequence
LOCUS 40924_15070 5882 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDONR-A-Hyg, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5882) AUTHORS Garcia-Pedrajas MD, Nadal M, Kapa LB, Perlin MH, Andrews DL, Gold SE. TITLE DelsGate, a robust and rapid gene deletion construction method JOURNAL Fungal Genet. Biol. 45 (4), 379-388 (2008) PUBMED 18248826 REFERENCE 2 (bases 1 to 5882) AUTHORS Garcia-Pedrajas MD, Nadal M, Kapa LB, Perlin MH, Andrews DL, Gold SE. TITLE Direct Submission JOURNAL Submitted (21-DEC-2007) Plant Pathology, University of Georgia, Miller Plant Sciences Bldg., Athens, GA 30602, USA REFERENCE 3 (bases 1 to 5882) TITLE Direct Submission REFERENCE 4 (bases 1 to 5882) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Fungal Genet. Biol."; date: "2008"; volume: "45"; issue: "4"; pages: "379-388" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-DEC-2007) Plant Pathology, University of Georgia, Miller Plant Sciences Bldg., Athens, GA 30602, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5882 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 335..566 /label=attP1 /note="recombination site for the Gateway(R) BP reaction" CDS complement(965..1267) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(1612..2268) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(2269..2371) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind complement(2516..2747) /label=attP2 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" CDS 2871..3677 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3823..4411 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(4546..4573) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(4665..4751) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS complement(4808..5830) /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANILFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK E" promoter complement(join(5835..5882,1..307)) /label=trpC promoter /note="promoter for Aspergillus nidulans trpC"
This page is informational only.