Basic Vector Information
- Vector Name:
- pDOJHR
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 8596 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Lee JH, O'sullivan DJ.
- Promoter:
- tet
pDOJHR vector Map
pDOJHR vector Sequence
LOCUS 40924_15015 8596 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pDOJHR, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8596) AUTHORS Lee JH, O'sullivan DJ. TITLE Sequence Analysis of Two Cryptic Plasmids from Bifidobacterium longum DJO10A and Construction of a Shuttle Cloning Vector JOURNAL Appl. Environ. Microbiol. 72 (1), 527-535 (2006) PUBMED 16391088 REFERENCE 2 (bases 1 to 8596) AUTHORS Lee J-H., O'Sullivan DJ. TITLE Direct Submission JOURNAL Submitted (11-JUL-2005) Food Science and Nutrition, University of Minnesota, 1500 Gortner Ave, St. Paul, MN 55108, USA REFERENCE 3 (bases 1 to 8596) TITLE Direct Submission REFERENCE 4 (bases 1 to 8596) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2006"; volume: "72"; issue: "1"; pages: "527-535" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JUL-2005) Food Science and Nutrition, University of Minnesota, 1500 Gortner Ave, St. Paul, MN 55108, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8596 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(1870..2328) /codon_start=1 /gene="cat" /product="chloramphenicol acetyltransferase" /label=cat /note="chloramphenicol resistance" /protein_id="AAZ32757.1" /translation="MNFNKIDLDNWKRKEIFNHYLNQQTTFSITTEIDISVLYRNIKQE GYKFYPAFIFLVTRVINSNTAFRTGYNSDGELGYWDKLEPLYTIFDGVSKTFSGIWTPV KNDFKEFYDLYLSDVEKYNGSGKLFPKTPIPEKCFFSFYYSMDFIYWV" gene complement(1870..2328) /gene="cat" /label=cat CDS 2791..2802 /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" promoter complement(4082..4186) /label=AmpR promoter primer_bind 4660..4676 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(4680..4736) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(4746..4762) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4770..4786) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4794..4824) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4839..4860) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter complement(5313..5341) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" rep_origin 5453..5998 /direction=RIGHT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(6200..7678) /codon_start=1 /gene="mob" /product="mobilization protein" /label=mob /protein_id="AAZ32759.1" /translation="MAIYSLNISSASSAVAALSYITSMRVRDDARGETYSGFGRRERVA HVATLLPEGAPSGYADPERLFNAAQAAERGTGVAAKKIMVALPRELDEGQRVLAVERFI RENLTAGGYAATYAIHLDREGRNPHAHILVANRRIDPRTGEWARLKQKTTFALDGNGQR IPVIDPKTGVQKVDKRNRKQWKRVTVSENPLGTKAMLLSMRESWADVCNGLLPEGVRID HRSLEEQGIDRVPTIHEGYASREMEKRGQPSDRMAINREIGASNRDLAEGDAAVDDLRA HQSELRRLLRDMADRAVQAFDRMLESIGHGVDPSDAVEAMRDRDGINLMIPRNAKDSDR PVWHAWLYDRHEWAAIPSHVLREGMRTVGRVRAAIGTALHRWRDAQAARRERIARSTPA QAPRLADVARQAREDAGQPAHQPRPVRKPEQQPEQQRERPVSLAAAAKEASKQLKREQQ QEPEPEPALEWNPWDPADPMNLGMGGSQGYGLGL" gene complement(6200..7678) /gene="mob" /label=mob CDS 8011..8493 /codon_start=1 /gene="orfIV" /product="hypothetical protein" /label=orfIV /protein_id="AAZ32760.1" /translation="MIEPIGGNEMPKSFAQQIEDDENKIKRIREHQRMVRAKQAKQERN ARTKRLVETGAIVEKAHGGAYDDEGRQTFSDGLNGIISVYDPSRGGNVDMRVIDVIDRR IPRLPRSETTTGTAAAASRTVQATAPQPAHAQPQSFTPNPQRIEHRTGAQQPDRWA" gene 8011..8493 /gene="orfIV" /label=orfIV
This page is informational only.