Basic Vector Information
- Vector Name:
- pDOE-11
- Antibiotic Resistance:
- Kanamycin
- Length:
- 11592 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Gookin TE, Assmann SM.
- Promoter:
- MAS
pDOE-11 vector Map
pDOE-11 vector Sequence
LOCUS 40924_14960 11592 bp DNA circular SYN 17-DEC-2018 DEFINITION Binary vector pDOE-11, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11592) AUTHORS Gookin TE, Assmann SM. TITLE Significant reduction of BiFC non-specific assembly facilitates in planta assessment of heterotrimeric G-protein interactors JOURNAL Plant J. (2014) In press PUBMED 25187041 REFERENCE 2 (bases 1 to 11592) AUTHORS Gookin TE, Assmann SM. TITLE Direct Submission JOURNAL Submitted (09-SEP-2014) Department of Biology, The Pennsylvania State University, 208 Mueller Laboratory, University Park, PA 16802, USA REFERENCE 3 (bases 1 to 11592) TITLE Direct Submission REFERENCE 4 (bases 1 to 11592) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J. (2014) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-SEP-2014) Department of Biology, The Pennsylvania State University, 208 Mueller Laboratory, University Park, PA 16802, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11592 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..25 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" misc_feature 99..104 /label=non-unique SacI /note="non-unique SacI" terminator complement(111..363) /label=MAS terminator /note="mannopine synthase terminator" misc_feature complement(373..406) /label=BAR gene remnant /note="BAR gene remnant" misc_feature 407..412 /label=MCS2 KpnI site /note="MCS2 KpnI site" CDS complement(416..1129) /label=mTurquoise2 /note="enhanced monomeric variant of CFP (Goedhart et al., 2012)" sig_peptide complement(1130..1234) /gene="XT-Golgi-mTq2" /note="exclusive localization to the medial Golgi cisternae; from Arabidopsis AtXylT/XYLT (beta-1,2-xylosyltransferase, At5g55500); characterized in PubMed ID 12943552; confirmed by Saint-Jore-Dupas et al. (Plant Cell 2006;18;3182-3200)" misc_feature 1235..1240 /label=MCS2 NruI site /note="MCS2 NruI site" regulatory complement(1238..1618) /note="mas1'-2' mannopine synthase promoter; mas2' drives MCS2 ORF; mas1' truncated by 96 nt; enhancer elements, TATA box, and start codon missing" /regulatory_class="promoter" promoter complement(1238..1618) /label=MAS promoter /note="mannopine synthase promoter (Velten et al., 1984)" regulatory 1631..2268 /note="UBQ10; Arabidopsis ubiquitin10 promoter" /regulatory_class="promoter" misc_difference 1784 /replace="g" /label=killed PmlI (CACcTG) /note="killed PmlI (CACcTG)" misc_feature 1965..2268 /label=cryptic intron from Norris et al. 1993 /note="cryptic intron from Norris et al. 1993" misc_difference 2197 /replace="t" /label=killed XbaI (aCTAGA) /note="killed XbaI (aCTAGA)" primer_bind 2269..2293 /label=pDOE mcs1F with XhoI /note="pDOE mcs1F with XhoI" misc_feature 2281..2297 /label=XhoSac linker /note="XhoSac linker" misc_feature 2308..2362 /label=TMV Omega /note="translational enhancer from the tobacco mosaic virus 5'-leader sequence (Gallie et al., 1988)" CDS 2364..3047 /codon_start=1 /gene="NmVen210-X" /product="NmVenus210-mcs1 fusion protein" /label=NmVen210-X /protein_id="AIN46645.1" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKGASGGGSGSMGR ALGTS" gene 2364..3047 /gene="NmVen210-X" /label=NmVen210-X misc_feature 2364..2993 /gene="NmVen210-X" /label=NmVenus210 specific sequence /note="NmVenus210 specific sequence" CDS 2364..2882 /codon_start=1 /product="N-terminal fragment of mVenus for use in bimolecular fluorescence complementation (BiFC) (Kodama and Hu, 2010)" /label=VN173 /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK ANFKIRHNIE" misc_difference 2982..2984 /gene="NmVen210-X" /label=A206K monomerizing mutation /note="A206K monomerizing mutation" misc_feature 2994..3047 /label=MCS1 front end /note="MCS1 front end" misc_feature 3048..3069 /label=MCS1 back end /note="MCS1 back end" terminator 3080..3787 /label=OCS terminator /note="octopine synthase terminator" regulatory 3808..4445 /note="UBQ10; ubiquitin10 promoter" /regulatory_class="promoter" misc_difference 3961 /replace="g" /label=killed PmlI (CACcTG) /note="killed PmlI (CACcTG)" misc_difference 4374 /replace="t" /label=killed XbaI (aCTAGA) /note="killed XbaI (aCTAGA)" primer_bind 4446..4470 /label=pDOE mcs3bF with Bsu36I /note="pDOE mcs3bF with Bsu36I" misc_feature 4453..4468 /label=Bsu361 linker /note="Bsu361 linker" regulatory 4469..4534 /label=TMV-Omega enhancer /note="TMV-Omega enhancer" /regulatory_class="enhancer" misc_feature 4479..4533 /label=TMV Omega /note="translational enhancer from the tobacco mosaic virus 5'-leader sequence (Gallie et al., 1988)" misc_feature 4535..4582 /label=MCS3 front end /note="MCS3 front end" CDS 4583..4606 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" CDS 4616..4639 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 4646..4669 /label=Strep-Tag II /note="peptide that binds Strep-Tactin(R), an engineered form of streptavidin" misc_feature 4682..4771 /gene="X-SFS-CVen210" /label=CVenus210 specific sequence /note="CVenus210 specific sequence" misc_feature 4772..4790 /label=MCS3 back end /note="MCS3 back end" terminator 4791..5043 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature 5053..5069 /label=remnant from pFGC5941 /note="remnant from pFGC5941" primer_bind complement(5094..5110) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 5313..5337 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 6638..7264 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS 7696..8766 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 8835..9029 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 9373..9513 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(9699..10287) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(10377..11168) /label=KanR /note="aminoglycoside phosphotransferase"
This page is informational only.