Basic Vector Information
- Vector Name:
- pDOE-08
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12959 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Gookin TE, Assmann SM.
- Promoter:
- MAS
pDOE-08 vector Map
pDOE-08 vector Sequence
LOCUS 40924_14945 12959 bp DNA circular SYN 17-DEC-2018
DEFINITION Binary vector pDOE-08, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12959)
AUTHORS Gookin TE, Assmann SM.
TITLE Significant reduction of BiFC non-specific assembly facilitates in
planta assessment of heterotrimeric G-protein interactors
JOURNAL Plant J. (2014) In press
PUBMED 25187041
REFERENCE 2 (bases 1 to 12959)
AUTHORS Gookin TE, Assmann SM.
TITLE Direct Submission
JOURNAL Submitted (09-SEP-2014) Department of Biology, The Pennsylvania
State University, 208 Mueller Laboratory, University Park, PA 16802,
USA
REFERENCE 3 (bases 1 to 12959)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12959)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J.
(2014) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-SEP-2014) Department of Biology, The Pennsylvania State
University, 208 Mueller Laboratory, University Park, PA 16802, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12959
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..25
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
misc_feature 99..104
/label=non-unique SacI
/note="non-unique SacI"
terminator complement(111..363)
/label=MAS terminator
/note="mannopine synthase terminator"
misc_feature complement(373..406)
/label=BAR gene remnant
/note="BAR gene remnant"
misc_feature 407..412
/label=MCS2 KpnI site
/note="MCS2 KpnI site"
CDS complement(416..1129)
/label=mTurquoise2
/note="enhanced monomeric variant of CFP (Goedhart et al.,
2012)"
sig_peptide complement(1130..1234)
/gene="XT-Golgi-mTq2"
/note="exclusive localization to the medial Golgi
cisternae; from Arabidopsis AtXylT/XYLT
(beta-1,2-xylosyltransferase, At5g55500); characterized in
PubMed ID 12943552; confirmed by Saint-Jore-Dupas et al.
(Plant Cell 2006;18;3182-3200)"
promoter complement(1238..1618)
/label=MAS promoter
/note="mannopine synthase promoter (Velten et al., 1984)"
promoter 2614..2959
/label=CaMV35S(short)
/note="Cauliflower mosaic virus 35S promoter (short)"
misc_feature 2962..2978
/label=XhoSac linker
/note="XhoSac linker"
misc_feature 2989..3043
/label=TMV Omega
/note="translational enhancer from the tobacco mosaic virus
5'-leader sequence (Gallie et al., 1988)"
CDS 3045..3728
/codon_start=1
/gene="NmVen210-X"
/product="NmVenus210-mcs1 fusion protein"
/label=NmVen210-X
/protein_id="AIN46633.1"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKGASGGGSGSMGR
ALGTS"
gene 3045..3728
/gene="NmVen210-X"
/label=NmVen210-X
misc_feature 3045..3674
/gene="NmVen210-X"
/label=NmVenus210 specific sequence
/note="NmVenus210 specific sequence"
CDS 3045..3563
/codon_start=1
/product="N-terminal fragment of mVenus for use in
bimolecular fluorescence complementation (BiFC) (Kodama and
Hu, 2010)"
/label=VN173
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
ANFKIRHNIE"
misc_difference 3663..3665
/gene="NmVen210-X"
/label=A206K monomerizing mutation
/note="A206K monomerizing mutation"
misc_feature 3675..3728
/label=MCS1 front end
/note="MCS1 front end"
misc_feature 3729..3750
/label=MCS1 back end
/note="MCS1 back end"
terminator 3761..4468
/label=OCS terminator
/note="octopine synthase terminator"
misc_feature 4477..4482
/label=non-unique NdeI
/note="non-unique NdeI"
promoter 5469..5814
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
primer_bind 5810..5834
/label=pDOE mcs3bF with Bsu36I
/note="pDOE mcs3bF with Bsu36I"
misc_feature 5817..5832
/label=Bsu361 linker
/note="Bsu361 linker"
regulatory 5833..5898
/label=TMV-Omega enhancer
/note="TMV-Omega enhancer"
/regulatory_class="enhancer"
misc_feature 5843..5897
/label=TMV Omega
/note="translational enhancer from the tobacco mosaic virus
5'-leader sequence (Gallie et al., 1988)"
misc_feature 5902..5988
/gene="CVen210-SFS-X"
/label=CVenus210 specific sequence
/note="CVenus210 specific sequence"
CDS 6001..6024
/label=Strep-Tag II
/note="peptide that binds Strep-Tactin(R), an engineered
form
of streptavidin"
CDS 6034..6057
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
CDS 6064..6087
/label=Strep-Tag II
/note="peptide that binds Strep-Tactin(R), an engineered
form
of streptavidin"
misc_feature 6103..6138
/gene="CVen210-SFS-X"
/label=MCS3 front end
/note="MCS3 front end"
misc_feature 6139..6156
/label=MCS3 back end
/note="MCS3 back end"
terminator 6158..6410
/label=NOS terminator
/note="nopaline synthase terminator and poly(A) signal"
misc_feature 6420..6436
/label=remnant from pFGC5941
/note="remnant from pFGC5941"
primer_bind complement(6461..6477)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 6680..6704
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
CDS 8005..8631
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 9063..10133
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 10202..10396
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
misc_feature 10740..10880
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(11066..11654)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(11744..12535)
/label=KanR
/note="aminoglycoside phosphotransferase"
This page is informational only.