pDOE-06 vector (V007954)

Basic Vector Information

Vector Name:
pDOE-06
Antibiotic Resistance:
Kanamycin
Length:
12956 bp
Type:
Binary vector
Replication origin:
ori
Source/Author:
Gookin TE, Assmann SM.
Promoter:
MAS

pDOE-06 vector Map

pDOE-0612956 bp6001200180024003000360042004800540060006600720078008400900096001020010800114001200012600LB T-DNA repeatnon-unique SacIMAS terminatorBAR gene remnantMCS2 KpnI sitemTurquoise2exclusive localization to the medial Golgi cisternae; from Arabidopsis AtXylT/XYLT (beta-1,2-xylosyltransferase, At5g55500); characterized in PubMed ID 12943552; confirmed by Saint-Jore-Dupas et al. (Plant Cell 2006;18;3182-3200)MAS promoterCaMV35S(short)XhoSac linkerTMV OmegaX-NmVen210MCS1 back endOCS terminatornon-unique NdeICaMV 35S promoterTMV-Omega enhancerCVenus210 specific sequenceStrep-Tag IIFLAGStrep-Tag IIMCS3 front endMCS3 back endNOS terminatorremnant from pFGC5941M13 fwdRB T-DNA repeatpVS1 StaApVS1 RepApVS1 oriVbomoriKanR

pDOE-06 vector Sequence

LOCUS       40924_14935       12956 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Binary vector pDOE-06, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12956)
  AUTHORS   Gookin TE, Assmann SM.
  TITLE     Significant reduction of BiFC non-specific assembly facilitates in 
            planta assessment of heterotrimeric G-protein interactors
  JOURNAL   Plant J. (2014) In press
  PUBMED    25187041
REFERENCE   2  (bases 1 to 12956)
  AUTHORS   Gookin TE, Assmann SM.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2014) Department of Biology, The Pennsylvania 
            State University, 208 Mueller Laboratory, University Park, PA 16802,
            USA
REFERENCE   3  (bases 1 to 12956)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12956)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant J. 
            (2014) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (09-SEP-2014) Department of Biology, The Pennsylvania State 
            University, 208 Mueller Laboratory, University Park, PA 16802, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12956
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..25
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     misc_feature    99..104
                     /label=non-unique SacI
                     /note="non-unique SacI"
     terminator      complement(111..363)
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     misc_feature    complement(373..406)
                     /label=BAR gene remnant
                     /note="BAR gene remnant"
     misc_feature    407..412
                     /label=MCS2 KpnI site
                     /note="MCS2 KpnI site"
     CDS             complement(416..1129)
                     /label=mTurquoise2
                     /note="enhanced monomeric variant of CFP (Goedhart et al., 
                     2012)"
     sig_peptide     complement(1130..1234)
                     /gene="XT-Golgi-mTq2"
                     /note="exclusive localization to the medial Golgi
                     cisternae; from Arabidopsis AtXylT/XYLT 
                     (beta-1,2-xylosyltransferase, At5g55500); characterized in 
                     PubMed ID 12943552; confirmed by Saint-Jore-Dupas et al. 
                     (Plant Cell 2006;18;3182-3200)"
     promoter        complement(1238..1618)
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     promoter        2614..2959
                     /label=CaMV35S(short)
                     /note="Cauliflower mosaic virus 35S promoter (short)"
     misc_feature    2962..2978
                     /label=XhoSac linker
                     /note="XhoSac linker"
     misc_feature    2989..3043
                     /label=TMV Omega
                     /note="translational enhancer from the tobacco mosaic virus
                     5'-leader sequence (Gallie et al., 1988)"
     CDS             3045..3725
                     /codon_start=1
                     /gene="X-NmVen210"
                     /product="mcs1-NmVenus210 fusion protein"
                     /label=X-NmVen210
                     /protein_id="AIN46625.1"
                     /translation="MGRALGTSGGSGGGSGMVSKGEELFTGVVPILVELDGDVNGHKFS
                     VSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSA
                     MPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYN
                     SHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQS
                     KLSK"
     gene            3045..3725
                     /gene="X-NmVen210"
                     /label=X-NmVen210
     misc_feature    3045..3092
                     /label=MCS1 front end
                     /note="MCS1 front end"
     misc_feature    3093..3725
                     /gene="X-NmVen210"
                     /label=NmVenus210 specific sequence
                     /note="NmVenus210 specific sequence"
     CDS             3093..3611
                     /codon_start=1
                     /product="N-terminal fragment of mVenus for use in
                     bimolecular fluorescence complementation (BiFC) (Kodama and
                     Hu, 2010)"
                     /label=VN173
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIE"
     misc_difference 3711..3713
                     /gene="X-NmVen210"
                     /label=A206K monomerizing mutation
                     /note="A206K monomerizing mutation"
     misc_feature    3726..3747
                     /label=MCS1 back end
                     /note="MCS1 back end"
     terminator      3758..4465
                     /label=OCS terminator
                     /note="octopine synthase terminator"
     misc_feature    4474..4479
                     /label=non-unique NdeI
                     /note="non-unique NdeI"
     promoter        5466..5811
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     primer_bind     5807..5831
                     /label=pDOE mcs3bF with Bsu36I
                     /note="pDOE mcs3bF with Bsu36I"
     misc_feature    5814..5829
                     /label=Bsu361 linker
                     /note="Bsu361 linker"
     regulatory      5830..5895
                     /label=TMV-Omega enhancer
                     /note="TMV-Omega enhancer"
                     /regulatory_class="enhancer"
     misc_feature    5840..5894
                     /label=TMV Omega
                     /note="translational enhancer from the tobacco mosaic virus
                     5'-leader sequence (Gallie et al., 1988)"
     misc_feature    5899..5985
                     /gene="CVen210-SFS-X"
                     /label=CVenus210 specific sequence
                     /note="CVenus210 specific sequence"
     CDS             5998..6021
                     /label=Strep-Tag II
                     /note="peptide that binds Strep-Tactin(R), an engineered 
                     form
                     of streptavidin"
     CDS             6031..6054
                     /label=FLAG
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     CDS             6061..6084
                     /label=Strep-Tag II
                     /note="peptide that binds Strep-Tactin(R), an engineered 
                     form
                     of streptavidin"
     misc_feature    6100..6135
                     /label=MCS3 front end
                     /note="MCS3 front end"
     misc_feature    6136..6153
                     /label=MCS3 back end
                     /note="MCS3 back end"
     terminator      6155..6407
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    6417..6433
                     /label=remnant from pFGC5941
                     /note="remnant from pFGC5941"
     primer_bind     complement(6458..6474)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    6677..6701
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             8002..8628
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             9060..10130
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      10199..10393
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    10737..10877
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(11063..11651)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(11741..12532)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"

This page is informational only.