pDOE-03 vector (V007957)

Basic Vector Information

Vector Name:
pDOE-03
Antibiotic Resistance:
Kanamycin
Length:
12653 bp
Type:
Binary vector
Replication origin:
ori
Source/Author:
Gookin TE, Assmann SM.
Promoter:
MAS

pDOE-03 vector Map

pDOE-0312653 bp6001200180024003000360042004800540060006600720078008400900096001020010800114001200012600LB T-DNA repeatnon-unique SacIMAS terminatorBAR gene remnantMCS2 KpnI siteRNA silencing suppressor p19MAS promoterCaMV35S(short)XhoSac linkerTMV OmegaNmVen210-XMCS1 back endOCS terminatornon-unique NdeICaMV 35S promoterTMV-Omega enhancerMCS3 front endStrep-Tag IIFLAGStrep-Tag IICVenus210 specific sequenceMCS3 back endNOS terminatorremnant from pFGC5941M13 fwdRB T-DNA repeatpVS1 StaApVS1 RepApVS1 oriVbomoriKanR

pDOE-03 vector Sequence

LOCUS       V007957                12653 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V007957
VERSION     V007957
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 12653)
  AUTHORS   Gookin TE, Assmann SM.
  TITLE     Significant reduction of BiFC non-specific assembly facilitates in
            planta assessment of heterotrimeric G-protein interactors
  JOURNAL   Plant J. (2014) In press
   PUBMED   25187041
REFERENCE   2  (bases 1 to 12653)
  AUTHORS   Gookin TE, Assmann SM.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2014) Department of Biology, The Pennsylvania
            State University, 208 Mueller Laboratory, University Park, PA 16802,
            USA
REFERENCE   3  (bases 1 to 12653)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12653)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant J.
            (2014) In press"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (09-SEP-2014) Department of Biology, The Pennsylvania State
            University, 208 Mueller Laboratory, University Park, PA 16802, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..12653
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..25
                     /label="LB T-DNA repeat"
                     /note="left border repeat from nopaline C58 T-DNA"
     misc_feature    99..104
                     /label="non-unique SacI"
                     /note="non-unique SacI"
     terminator      complement(111..363)
                     /label="MAS terminator"
                     /note="mannopine synthase terminator"
     misc_feature    complement(373..406)
                     /label="BAR gene remnant"
                     /note="BAR gene remnant"
     misc_feature    407..412
                     /label="MCS2 KpnI site"
                     /note="MCS2 KpnI site"
     CDS             complement(416..931)
                     /note="RNA silencing suppressor p19 from Tomato bushy stunt
                     virus (strain Cherry). Accession#: P11690"
                     /label="RNA silencing suppressor p19"
     promoter        complement(935..1315)
                     /label="MAS promoter"
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     promoter        2311..2656
                     /label="CaMV35S(short)"
                     /note="Cauliflower mosaic virus 35S promoter (short)"
     misc_feature    2659..2675
                     /label="XhoSac linker"
                     /note="XhoSac linker"
     misc_feature    2686..2740
                     /label="TMV Omega"
                     /note="translational enhancer from the tobacco mosaic virus
                     5'-leader sequence (Gallie et al., 1988)"
     CDS             2742..3425
                     /codon_start=1
                     /gene="NmVen210-X"
                     /product="NmVenus210-mcs1 fusion protein"
                     /label="NmVen210-X"
                     /protein_id="AIN46613.1"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKGASGGGSGSMGR
                     ALGTS"
     gene            2742..3425
                     /gene="NmVen210-X"
                     /label="NmVen210-X"
     misc_feature    2742..3371
                     /gene="NmVen210-X"
                     /label="NmVenus210 specific sequence"
                     /note="NmVenus210 specific sequence"
     CDS             2742..3260
                     /codon_start=1
                     /product="N-terminal fragment of mVenus for use in
                     bimolecular fluorescence complementation (BiFC) (Kodama and
                     Hu, 2010)"
                     /label="VN173"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
                     ANFKIRHNIE"
     misc_difference 3360..3362
                     /gene="NmVen210-X"
                     /label="A206K monomerizing mutation"
                     /note="A206K monomerizing mutation"
     misc_feature    3372..3422
                     /label="MCS1 front end"
                     /note="MCS1 front end"
     misc_feature    3426..3447
                     /label="MCS1 back end"
                     /note="MCS1 back end"
     terminator      3458..4165
                     /label="OCS terminator"
                     /note="octopine synthase terminator"
     misc_feature    4174..4179
                     /label="non-unique NdeI"
                     /note="non-unique NdeI"
     promoter        5166..5511
                     /label="CaMV 35S promoter"
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     primer_bind     5507..5531
                     /label="pDOE mcs3bF with Bsu36I"
                     /note="pDOE mcs3bF with Bsu36I"
     misc_feature    5514..5529
                     /label="Bsu361 linker"
                     /note="Bsu361 linker"
     regulatory      5530..5595
                     /label="TMV-Omega enhancer"
                     /note="TMV-Omega enhancer"
                     /regulatory_class="enhancer"
     misc_feature    5540..5594
                     /label="TMV Omega"
                     /note="translational enhancer from the tobacco mosaic virus
                     5'-leader sequence (Gallie et al., 1988)"
     misc_feature    5596..5643
                     /label="MCS3 front end"
                     /note="MCS3 front end"
     CDS             5644..5667
                     /label="Strep-Tag II"
                     /note="peptide that binds Strep-Tactin(R), an engineered
                     form of streptavidin"
     CDS             5677..5700
                     /label="FLAG"
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     CDS             5707..5730
                     /label="Strep-Tag II"
                     /note="peptide that binds Strep-Tactin(R), an engineered
                     form of streptavidin"
     misc_feature    5743..5832
                     /gene="X-SFS-CVen210"
                     /label="CVenus210 specific sequence"
                     /note="CVenus210 specific sequence"
     misc_feature    5833..5851
                     /label="MCS3 back end"
                     /note="MCS3 back end"
     terminator      5852..6104
                     /label="NOS terminator"
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    6114..6130
                     /label="remnant from pFGC5941"
                     /note="remnant from pFGC5941"
     primer_bind     complement(6155..6171)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     misc_feature    6374..6398
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             7699..8325
                     /label="pVS1 StaA"
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             8757..9827
                     /label="pVS1 RepA"
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      9896..10090
                     /label="pVS1 oriV"
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    10434..10574
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(10760..11348)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(11438..12229)
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"

This page is informational only.