Basic Vector Information
- Vector Name:
- pDOE-02
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12653 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Gookin TE, Assmann SM.
- Promoter:
- MAS
pDOE-02 vector Map
pDOE-02 vector Sequence
LOCUS V007958 12653 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V007958
VERSION V007958
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 12653)
AUTHORS Gookin TE, Assmann SM.
TITLE Significant reduction of BiFC non-specific assembly facilitates in
planta assessment of heterotrimeric G-protein interactors
JOURNAL Plant J. (2014) In press
PUBMED 25187041
REFERENCE 2 (bases 1 to 12653)
AUTHORS Gookin TE, Assmann SM.
TITLE Direct Submission
JOURNAL Submitted (09-SEP-2014) Department of Biology, The Pennsylvania
State University, 208 Mueller Laboratory, University Park, PA 16802,
USA
REFERENCE 3 (bases 1 to 12653)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12653)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant J.
(2014) In press"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-SEP-2014) Department of Biology, The Pennsylvania State
University, 208 Mueller Laboratory, University Park, PA 16802, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12653
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..25
/label="LB T-DNA repeat"
/note="left border repeat from nopaline C58 T-DNA"
misc_feature 99..104
/label="non-unique SacI"
/note="non-unique SacI"
terminator complement(111..363)
/label="MAS terminator"
/note="mannopine synthase terminator"
misc_feature complement(373..406)
/label="BAR gene remnant"
/note="BAR gene remnant"
misc_feature 407..412
/label="MCS2 KpnI site"
/note="MCS2 KpnI site"
CDS complement(416..931)
/note="RNA silencing suppressor p19 from Tomato bushy stunt
virus (strain Cherry). Accession#: P11690"
/label="RNA silencing suppressor p19"
promoter complement(935..1315)
/label="MAS promoter"
/note="mannopine synthase promoter (Velten et al., 1984)"
promoter 2311..2656
/label="CaMV35S(short)"
/note="Cauliflower mosaic virus 35S promoter (short)"
misc_feature 2659..2675
/label="XhoSac linker"
/note="XhoSac linker"
misc_feature 2686..2740
/label="TMV Omega"
/note="translational enhancer from the tobacco mosaic virus
5'-leader sequence (Gallie et al., 1988)"
CDS 2742..3422
/codon_start=1
/gene="X-NmVen210"
/product="mcs1-NmVenus210 fusion protein"
/label="X-NmVen210"
/protein_id="AIN46609.1"
/translation="MGRALGTSGGSGGGSGMVSKGEELFTGVVPILVELDGDVNGHKFS
VSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSA
MPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYN
SHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQS
KLSK"
gene 2742..3422
/gene="X-NmVen210"
/label="X-NmVen210"
misc_feature 2742..2789
/label="MCS1 front end"
/note="MCS1 front end"
misc_feature 2790..3422
/gene="X-NmVen210"
/label="NmVenus210 specific sequence"
/note="NmVenus210 specific sequence"
CDS 2790..3308
/codon_start=1
/product="N-terminal fragment of mVenus for use in
bimolecular fluorescence complementation (BiFC) (Kodama and
Hu, 2010)"
/label="VN173"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
KLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIK
ANFKIRHNIE"
misc_difference 3408..3410
/gene="X-NmVen210"
/label="A206K monomerizing mutation"
/note="A206K monomerizing mutation"
misc_feature 3423..3444
/label="MCS1 back end"
/note="MCS1 back end"
terminator 3455..4162
/label="OCS terminator"
/note="octopine synthase terminator"
misc_feature 4171..4176
/label="non-unique NdeI"
/note="non-unique NdeI"
promoter 5163..5508
/label="CaMV 35S promoter"
/note="strong constitutive promoter from cauliflower mosaic
virus"
primer_bind 5504..5528
/label="pDOE mcs3bF with Bsu36I"
/note="pDOE mcs3bF with Bsu36I"
misc_feature 5511..5526
/label="Bsu361 linker"
/note="Bsu361 linker"
regulatory 5527..5592
/label="TMV-Omega enhancer"
/note="TMV-Omega enhancer"
/regulatory_class="enhancer"
misc_feature 5537..5591
/label="TMV Omega"
/note="translational enhancer from the tobacco mosaic virus
5'-leader sequence (Gallie et al., 1988)"
misc_feature 5596..5682
/gene="CVen210-SFS-X"
/label="CVenus210 specific sequence"
/note="CVenus210 specific sequence"
CDS 5695..5718
/label="Strep-Tag II"
/note="peptide that binds Strep-Tactin(R), an engineered
form of streptavidin"
CDS 5728..5751
/label="FLAG"
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
CDS 5758..5781
/label="Strep-Tag II"
/note="peptide that binds Strep-Tactin(R), an engineered
form of streptavidin"
misc_feature 5797..5832
/label="MCS3 front end"
/note="MCS3 front end"
misc_feature 5833..5850
/label="MCS3 back end"
/note="MCS3 back end"
terminator 5852..6104
/label="NOS terminator"
/note="nopaline synthase terminator and poly(A) signal"
misc_feature 6114..6130
/label="remnant from pFGC5941"
/note="remnant from pFGC5941"
primer_bind complement(6155..6171)
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 6374..6398
/label="RB T-DNA repeat"
/note="right border repeat from nopaline C58 T-DNA"
CDS 7699..8325
/label="pVS1 StaA"
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 8757..9827
/label="pVS1 RepA"
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 9896..10090
/label="pVS1 oriV"
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
misc_feature 10434..10574
/label="bom"
/note="basis of mobility region from pBR322"
rep_origin complement(10760..11348)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(11438..12229)
/label="KanR"
/note="aminoglycoside phosphotransferase"
This page is informational only.