Basic Vector Information
- Vector Name:
- pDN19
- Antibiotic Resistance:
- Tetracycline
- Length:
- 7827 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Marx CJ, Lidstrom ME.
pDN19 vector Map
pDN19 vector Sequence
LOCUS 40924_14870 7827 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pDN19, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7827) AUTHORS Marx CJ, Lidstrom ME. TITLE Development of improved versatile broad-host-range vectors for use in methylotrophs and other Gram-negative bacteria JOURNAL Microbiology 147 (Pt 8), 2065-2075 (2001) PUBMED 11495985 REFERENCE 2 (bases 1 to 7827) AUTHORS Marx CJ, Lidstrom ME. TITLE Direct Submission JOURNAL Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 7827) TITLE Direct Submission REFERENCE 4 (bases 1 to 7827) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology 147 (Pt 8), 2065-2075 (2001)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7827 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 3..712 /label=oriV /note="incP origin of replication" primer_bind 2725..2741 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 2742..2798 /label=MCS /note="pUC18/19 multiple cloning site" promoter complement(2801..2819) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2838..2854) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2862..2878) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2886..2916) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2931..2952) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS 3280..4476 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="VKPNIPLIVILSTVALDAVGIGLIMPVLPGLLRDLVHSNDVTAHY GILLALYALVQFACAPVLGALSDRFGRRPILLVSLAGATVDYAIMATAPFLWVLYIGRI VAGITGATGAVAGAYIADITDGDERARHFGFMSACFGFGMVAGPVLGGLMGGFSPHAPF FAAAALNGLNFLTGCFLLPESHKGERRPLRREALNPLASFRWARGMTVVAALMAVFFIM QLVGQVPAALWVIFGEDRFHWDATTIGISLAAFGILHSLAQAMITGPVAARLGERRALM LGMIADGTGYILLAFATRGWMAFPIMVLLASGGIGMPALQAMLSRQVDEERQGQLQGSL AALTSLTSIVGPLLFTAIYAASITTWNGWAWIAGAALYLLCLPALRRGLWSGAGQRADR " CDS complement(5755..6900) /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" CDS complement(7175..7543) /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" oriT complement(7576..7685) /direction=LEFT /label=oriT /note="incP origin of transfer"
This page is informational only.