pDMK3 vector (V007968)

Download GeneBank File(.gb)

LOCUS       40924_14865        6820 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pDMK3, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6820)
  AUTHORS   Kadzhaev K, Zingmark C, Golovliov I, Bolanowski M, Shen H, Conlan W,
            Sjostedt A.
  TITLE     Identification of genes contributing to the virulence of Francisella
            tularensis SCHU S4 in a mouse intradermal infection model
  JOURNAL   PLoS ONE 4 (5), E5463 (2009)
  PUBMED    19424499
REFERENCE   2  (bases 1 to 6820)
  AUTHORS   Kadzhaev K, Golovliov I, Sjostedt A.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-MAR-2009) Clinical Bacteriology, Umea University, NUS,
            Umea 90185, Sweden
REFERENCE   3  (bases 1 to 6820)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6820)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; 
            date: "2009"; volume: "4"; issue: "5"; pages: "E5463"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-MAR-2009) Clinical Bacteriology, Umea University, NUS, Umea 
            90185, Sweden"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6820
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    complement(120..136)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     rep_origin      complement(171..559)
                     /direction=LEFT
                     /label=R6K gamma ori
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     CDS             complement(585..1142)
                     /codon_start=1
                     /gene="traI"
                     /product="TraI"
                     /label=traI
                     /protein_id="ACO50702.1"
                     /translation="MIAKHVPMRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANT
                     LPAVMAEVMATQHGNTRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQR
                     VSAVHHDTDNLHIHIAINKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQ
                     RVSENRANDMERHAGVESLVGWI"
     gene            complement(585..1142)
                     /gene="traI"
                     /label=traI
     CDS             complement(1139..1180)
                     /codon_start=1
                     /gene="traX"
                     /product="TraX"
                     /label=traX
                     /protein_id="ACO50703.1"
                     /translation="MTFLAAKTAGGCA"
     gene            complement(1139..1180)
                     /gene="traX"
                     /label=traX
     CDS             complement(1180..1548)
                     /label=traJ
                     /note="oriT-recognizing protein"
     oriT            complement(1581..1690)
                     /direction=LEFT
                     /label=oriT
                     /note="incP origin of transfer"
     CDS             1916..2312
                     /codon_start=1
                     /gene="traK"
                     /product="TraK"
                     /label=traK
                     /protein_id="ACO50705.1"
                     /translation="MPKSYTDELAEWVESRAAKKRRRDEAAVAFLAVRADVEAALASGY
                     ALVTIWEHMRETGKVKFSYETFRSHARRHIKAKPADVPAPQAKAAEPAPAPKTPEPRRP
                     KQGGKAEKPAPAAAPTGFTFNPTPDKKD"
     gene            1916..2312
                     /gene="traK"
                     /label=traK
     promoter        3127..3572
                     /label=sacB promoter
                     /note="sacB promoter and control region"
     CDS             3573..4991
                     /label=SacB
                     /note="secreted levansucrase that renders bacterial growth 
                     sensitive to sucrose"
     regulatory      5711..6018
                     /label=groES promoter
                     /note="groES promoter"
                     /regulatory_class="promoter"
     CDS             6026..6817
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"