Basic Vector Information
- Vector Name:
- pDM360
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8059 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Veltman DM, Keizer-Gunnink I, Haastert PJ.
pDM360 vector Vector Map
pDM360 vector Sequence
LOCUS V007970 8059 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V007970 VERSION V007970 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8059) AUTHORS Veltman DM, Keizer-Gunnink I, Haastert PJ. TITLE An extrachromosomal, inducible expression system for Dictyostelium discoideum JOURNAL Plasmid 61 (2), 119-125 (2009) PUBMED 19046986 REFERENCE 2 (bases 1 to 8059) AUTHORS Veltman DM, Keizer I, van Haastert PJM. TITLE Direct Submission JOURNAL Submitted (17-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren, Groningen 9751 NN, The Netherlands REFERENCE 3 (bases 1 to 8059) TITLE Direct Submission REFERENCE 4 (bases 1 to 8059) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "61"; issue: "2"; pages: "119-125" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren, Groningen 9751 NN, The Netherlands" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8059 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 28..298 /label="tetracycline response element" /note="contains seven copies of the tetracycline operator tetO" regulatory 473..734 /label="act8 terminator" /note="act8 terminator" /regulatory_class="terminator" regulatory complement(741..995) /label="mhcA terminator" /note="mhcA terminator" /regulatory_class="terminator" CDS complement(1005..1424) /gene="bsr" /label="Blasticidin-S deaminase" /note="Blasticidin-S deaminase from Bacillus cereus. Accession#: P33967" regulatory complement(1436..1657) /label="act6 promoter" /note="act6 promoter" /regulatory_class="promoter" promoter 1712..1816 /label="AmpR promoter" CDS 1817..2674 /label="AmpR" /note="beta-lactamase" rep_origin 2848..3436 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 3649..3932 /label="act15 promoter" /note="act15 promoter" /regulatory_class="promoter" CDS 3945..4565 /label="TetR" /note="tetracycline repressor TetR" CDS 4587..4820 /label="VP16 AD" /note="transcriptional activation domain of herpes simplex virus protein VP16 (Triezenberg et al., 1988; Cousens et al., 1989)" regulatory 4862..5123 /label="act8 terminator" /note="act8 terminator" /regulatory_class="terminator" rep_origin complement(5248..5790) /direction=LEFT /label="Ddp1 ori" /note="Ddp1 ori" CDS 5700..6293 /codon_start=1 /product="G5" /label="G5" /protein_id="ACG80845.1" /translation="MFNHIKDSGYYATNEEIEIFLESCTLCKEITAQTKRNSYKKRNII NKLPEEEEEEEEEEEEEEEEEEQEEEVEKPTISEEEEEETPAVSEEEKEEEEQEEDKEK DKEKKIEEDTETGKKKDEVMNERQDGIEISEKTNDKPTEKTKVKKNVSRVKDINLHKKG NPITPKKIKNFSQQQLRLASGVSNEKRAIITLKK" CDS complement(6301..7065) /codon_start=1 /product="D5" /label="D5" /protein_id="ACG80846.1" /translation="MYSTTLLFFLFFFIVSKSSVLQNDQIEVKYFQLLIVMYQKENCVE KSMTGAVIYDECNIHGRVETNSTHALFYDDIETNNSRCNNFRNLTNLIKLNECINDEFG ESILYKEYNETDDGYLFRVEDSFVEITSLSMDCTKNSKTIIEKFNICSKFENVYHITNI TQEKSNRFTCTDPLCHYCKNENIQNNLDFKTTKCTPKYGASDSEFLSTIYNPKLDGSNN GMEKSVTQEKNISNNLKINIYLIFFLIIFLIK" CDS complement(7568..8059) /codon_start=1 /product="D1'" /label="D1'" /protein_id="ACG80847.1" /translation="MDFEKVNSNYYKIQSESTQINSNEIADLKKFIKEEVNKTSSKIDF FLVSSTDALSNPENYSLLEVKCINCHSLCQGKNLYISCTRDGCQNNICYNCLGININIY NVVINSKLCPPCFNDSVINKKCAMCSKNGTKCNLNQECKLHLCAQCSKKCLYILRVKTN "
This page is informational only.