Basic Vector Information
- Vector Name:
- pDM326
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6431 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Veltman DM, Akar G, Bosgraaf L, Van Haastert PJ.
pDM326 vector Map
pDM326 vector Sequence
LOCUS V007974 6431 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V007974 VERSION V007974 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6431) AUTHORS Veltman DM, Akar G, Bosgraaf L, Van Haastert PJ. TITLE A new set of small, extrachromosomal expression vectors for Dictyostelium discoideum JOURNAL Plasmid 61 (2), 110-118 (2009) PUBMED 19063918 REFERENCE 2 (bases 1 to 6431) AUTHORS Veltman DM, Akar G, Bosgraaf L, van Haastert PJM. TITLE Direct Submission JOURNAL Submitted (19-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren 9751 NN, The Netherlands REFERENCE 3 (bases 1 to 6431) TITLE Direct Submission REFERENCE 4 (bases 1 to 6431) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "61"; issue: "2"; pages: "110-118" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren 9751 NN, The Netherlands" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6431 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 14..303 /label="act15 promoter" /note="act15 promoter" /regulatory_class="promoter" regulatory 332..594 /label="act8 terminator" /note="act8 terminator" /regulatory_class="terminator" CDS 606..1091 /codon_start=1 /product="D1'" /label="D1'" /protein_id="ACH81556.1" /translation="FEKVNSNYYKIQSESTQINSNEIADLKKFIKEEVNKTSSKIDFFL VSSTDALSNPENYSLLEVKCINCHSLCQGKNLYISCTRDGCQNNICYNCLGININIYNV VINSKLCPPCFNDSVINKKCAMCSKNGTKCNLNQECKLHLCAQCSKKCLYILRVKTN" CDS 1594..2358 /codon_start=1 /product="D5" /label="D5" /protein_id="ACH81557.1" /translation="MYSTTLLFFLFFFIVSKSSVLQNDQIEVKYFQLLIVMYQKENCVE KSMTGAVIYDECNIHGRVETNSTHALFYDDIETNNSRCNNFRNLTNLIKLNECINDEFG ESILYKEYNETDDGYLFRVEDSFVEITSLSMDCTKNSKTIIEKFNICSKFENVYHITNI TQEKSNRFTCTDPLCHYCKNENIQNNLDFKTTKCTPKYGASDSEFLSTIYNPKLDGSNN GMEKSVTQEKNISNNLKINIYLIFFLIIFLIK" CDS complement(2366..2959) /codon_start=1 /product="G5" /label="G5" /protein_id="ACH81558.1" /translation="MFNHIKDSGYYATNEEIEIFLESCTLCKEITAQTKRNSYKKRNII NKLPEEEEEEEEEEEEEEEEEEQEEEVEKPTISEEEEEETPAVSEEEKEEEEQEEDKEK DKEKKIEEDTETGKKKDEVMNERQDGIEISEKTNDKPTEKTKVKKNVSRVKDINLHKKG NPITPKKIKNFSQQQLRLASGVSNEKRAIITLKK" rep_origin 2869..3411 /label="Ddp1 ori" /note="Ddp1 ori" rep_origin complement(3742..4330) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4504..5361) /label="AmpR" /note="beta-lactamase" promoter complement(5362..5466) /label="AmpR promoter" regulatory complement(5513..5768) /label="mhcA terminator" /note="mhcA terminator" /regulatory_class="terminator" CDS complement(5778..6197) /gene="bsr" /label="Blasticidin-S deaminase" /note="Blasticidin-S deaminase from Bacillus cereus. Accession#: P33967" regulatory complement(6209..6430) /label="act6 promoter" /note="act6 promoter" /regulatory_class="promoter"
This page is informational only.