Basic Vector Information
- Vector Name:
- pDM320
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6878 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Veltman DM, Akar G, Bosgraaf L, Van Haastert PJ.
pDM320 vector Map
pDM320 vector Sequence
LOCUS 40924_14830 6878 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pDM320, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6878) AUTHORS Veltman DM, Akar G, Bosgraaf L, Van Haastert PJ. TITLE A new set of small, extrachromosomal expression vectors for Dictyostelium discoideum JOURNAL Plasmid 61 (2), 110-118 (2009) PUBMED 19063918 REFERENCE 2 (bases 1 to 6878) AUTHORS Veltman DM, Akar G, Bosgraaf L, van Haastert PJM. TITLE Direct Submission JOURNAL Submitted (19-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren 9751 NN, The Netherlands REFERENCE 3 (bases 1 to 6878) TITLE Direct Submission REFERENCE 4 (bases 1 to 6878) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "61"; issue: "2"; pages: "110-118" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren 9751 NN, The Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6878 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 14..303 /label=act15 promoter /note="act15 promoter" /regulatory_class="promoter" CDS 321..344 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" regulatory 371..633 /label=act8 terminator /note="act8 terminator" /regulatory_class="terminator" CDS 645..1130 /codon_start=1 /product="D1'" /label=D1' /protein_id="ACH81551.1" /translation="FEKVNSNYYKIQSESTQINSNEIADLKKFIKEEVNKTSSKIDFFL VSSTDALSNPENYSLLEVKCINCHSLCQGKNLYISCTRDGCQNNICYNCLGININIYNV VINSKLCPPCFNDSVINKKCAMCSKNGTKCNLNQECKLHLCAQCSKKCLYILRVKTN" CDS 1633..2397 /codon_start=1 /product="D5" /label=D5 /protein_id="ACH81552.1" /translation="MYSTTLLFFLFFFIVSKSSVLQNDQIEVKYFQLLIVMYQKENCVE KSMTGAVIYDECNIHGRVETNSTHALFYDDIETNNSRCNNFRNLTNLIKLNECINDEFG ESILYKEYNETDDGYLFRVEDSFVEITSLSMDCTKNSKTIIEKFNICSKFENVYHITNI TQEKSNRFTCTDPLCHYCKNENIQNNLDFKTTKCTPKYGASDSEFLSTIYNPKLDGSNN GMEKSVTQEKNISNNLKINIYLIFFLIIFLIK" CDS complement(2405..2998) /codon_start=1 /product="G5" /label=G5 /protein_id="ACH81553.1" /translation="MFNHIKDSGYYATNEEIEIFLESCTLCKEITAQTKRNSYKKRNII NKLPEEEEEEEEEEEEEEEEEEQEEEVEKPTISEEEEEETPAVSEEEKEEEEQEEDKEK DKEKKIEEDTETGKKKDEVMNERQDGIEISEKTNDKPTEKTKVKKNVSRVKDINLHKKG NPITPKKIKNFSQQQLRLASGVSNEKRAIITLKK" rep_origin 2908..3450 /label=Ddp1 ori /note="Ddp1 ori" rep_origin complement(3781..4369) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4543..5400) /label=AmpR /note="beta-lactamase" promoter complement(5401..5505) /label=AmpR promoter regulatory complement(5552..5807) /label=mhcA terminator /note="mhcA terminator" /regulatory_class="terminator" CDS complement(5817..6608) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory complement(6656..6877) /label=act6 promoter /note="act6 promoter" /regulatory_class="promoter"
This page is informational only.