Basic Vector Information
- Vector Name:
- pDM309
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8596 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Veltman DM, Keizer-Gunnink I, Haastert PJ.
pDM309 vector Map
pDM309 vector Sequence
LOCUS 40924_14810 8596 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pDM309, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8596) AUTHORS Veltman DM, Keizer-Gunnink I, Haastert PJ. TITLE An extrachromosomal, inducible expression system for Dictyostelium discoideum JOURNAL Plasmid 61 (2), 119-125 (2009) PUBMED 19046986 REFERENCE 2 (bases 1 to 8596) AUTHORS Veltman DM, Keizer I, van Haastert PJM. TITLE Direct Submission JOURNAL Submitted (17-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren, Groningen 9751 NN, The Netherlands REFERENCE 3 (bases 1 to 8596) TITLE Direct Submission REFERENCE 4 (bases 1 to 8596) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "61"; issue: "2"; pages: "119-125" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-JUL-2008) Cell Biochemistry, Rijks Universiteit Groningen, Kerklaan 30, Haren, Groningen 9751 NN, The Netherlands" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8596 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 28..298 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" regulatory 473..734 /label=act8 terminator /note="act8 terminator" /regulatory_class="terminator" regulatory complement(741..995) /label=mhcA terminator /note="mhcA terminator" /regulatory_class="terminator" CDS complement(1005..1796) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory complement(1844..2065) /label=act6 promoter /note="act6 promoter" /regulatory_class="promoter" promoter 2120..2224 /label=AmpR promoter CDS 2225..3082 /label=AmpR /note="beta-lactamase" rep_origin 3256..3844 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory 4057..4340 /label=act15 promoter /note="act15 promoter" /regulatory_class="promoter" CDS 4353..5357 /label=tTA /note="tetracycline-controlled transactivator, comprising a fusion of the tetracycline repressor TetR with the C-terminal activation domain of herpes simplex virus VP16" regulatory 5399..5660 /label=act8 terminator /note="act8 terminator" /regulatory_class="terminator" rep_origin complement(5785..6327) /direction=LEFT /label=Ddp1 ori /note="Ddp1 ori" CDS 6237..6830 /codon_start=1 /product="G5" /label=G5 /protein_id="ACG80851.1" /translation="MFNHIKDSGYYATNEEIEIFLESCTLCKEITAQTKRNSYKKRNII NKLPEEEEEEEEEEEEEEEEEEQEEEVEKPTISEEEEEETPAVSEEEKEEEEQEEDKEK DKEKKIEEDTETGKKKDEVMNERQDGIEISEKTNDKPTEKTKVKKNVSRVKDINLHKKG NPITPKKIKNFSQQQLRLASGVSNEKRAIITLKK" CDS complement(6838..7602) /codon_start=1 /product="D5" /label=D5 /protein_id="ACG80852.1" /translation="MYSTTLLFFLFFFIVSKSSVLQNDQIEVKYFQLLIVMYQKENCVE KSMTGAVIYDECNIHGRVETNSTHALFYDDIETNNSRCNNFRNLTNLIKLNECINDEFG ESILYKEYNETDDGYLFRVEDSFVEITSLSMDCTKNSKTIIEKFNICSKFENVYHITNI TQEKSNRFTCTDPLCHYCKNENIQNNLDFKTTKCTPKYGASDSEFLSTIYNPKLDGSNN GMEKSVTQEKNISNNLKINIYLIFFLIIFLIK" CDS complement(8105..8596) /codon_start=1 /product="D1'" /label=D1' /protein_id="ACG80853.1" /translation="MDFEKVNSNYYKIQSESTQINSNEIADLKKFIKEEVNKTSSKIDF FLVSSTDALSNPENYSLLEVKCINCHSLCQGKNLYISCTRDGCQNNICYNCLGININIY NVVINSKLCPPCFNDSVINKKCAMCSKNGTKCNLNQECKLHLCAQCSKKCLYILRVKTN "
This page is informational only.