Basic Vector Information
- Vector Name:
- pDM2L
- Antibiotic Resistance:
- Tetracycline
- Length:
- 12210 bp
- Type:
- Cloning vector
- Replication origin:
- ori2
- Source/Author:
- Chan CT, Lee JW, Cameron DE, Bashor CJ, Collins JJ.
pDM2L vector Map
pDM2L vector Sequence
LOCUS 40924_14800 12210 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pDM2L, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 12210) AUTHORS Chan CT, Lee JW, Cameron DE, Bashor CJ, Collins JJ. TITLE 'Deadman' and 'Passcode' microbial kill switches for bacterial containment JOURNAL Nat. Chem. Biol. 12 (2), 82-86 (2016) PUBMED 26641934 REFERENCE 2 (bases 1 to 12210) AUTHORS Chan CTY., Lee JW, Cameron DE, Bashor CJ, Collins JJ. TITLE Direct Submission JOURNAL Submitted (12-OCT-2015) Biological engineering, MIT, 45 Carleton St, MIT Building E25-Rm302, Cambridge, MA 02142, USA REFERENCE 3 (bases 1 to 12210) TITLE Direct Submission REFERENCE 4 (bases 1 to 12210) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem. Biol."; date: "2016"; volume: "12"; issue: "2"; pages: "82-86" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-OCT-2015) Biological engineering, MIT, 45 Carleton St, MIT Building E25-Rm302, Cambridge, MA 02142, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..12210 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(105..1073) /label=sopB /note="partitioning protein for the bacterial F plasmid" CDS complement(1076..2248) /label=sopA /note="partitioning protein for the bacterial F plasmid" misc_feature complement(2574..2824) /label=incC /note="incompatibility region of the bacterial F plasmid" CDS complement(2830..3582) /label=repE /note="replication initiation protein for the bacterial F plasmid" rep_origin complement(3673..3892) /direction=LEFT /label=ori2 /note="secondary origin of replication for the bacterial F plasmid; also known as oriS" rep_origin complement(3968..4582) /direction=LEFT /label=oriV /note="origin of replication for the bacterial F plasmid" promoter 5440..5542 /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS 5543..6199 /label=CmR /note="chloramphenicol acetyltransferase" terminator complement(6337..6431) /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS complement(6494..7207) /label=yeGFP /note="yeast-enhanced green fluorescent protein" RBS 7213..7221 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" regulatory complement(7249..7322) /label=PLtetO promoter /note="PLtetO promoter" /regulatory_class="promoter" promoter complement(7249..7322) /label=PLtetO-1 promoter /note="modified phage lambda PL promoter with tet operator sites (Lutz and Bujard, 1997)" misc_feature 7268 /label=transcription start site /note="transcription start site" protein_bind 7304..7322 /gene="tetO" /label=tet operator /bound_moiety="tetracycline repressor TetR" /note="bacterial operator O2 for the tetR and tetA genes" misc_feature complement(7365..7448) /label=ssrA tag (mf-lon) /note="ssrA tag (mf-lon)" CDS complement(7449..8528) /label=lacI /note="lac repressor" RBS 8534..8542 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" promoter complement(8564..8637) /label=PLtetO-1 promoter /note="modified phage lambda PL promoter with tet operator sites (Lutz and Bujard, 1997)" promoter 8669..8698 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" misc_feature 8704 /label=transcription start site /note="transcription start site" protein_bind 8706..8722 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 8755..8763 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 8769..9389 /label=TetR /note="tetracycline repressor TetR" regulatory 9397..9509 /label=rnpBT1 terminator /note="rnpBT1 terminator" /regulatory_class="terminator" protein_bind 9528..9547 /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." protein_bind 9564..9583 /label=lac operator (symmetric) /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." promoter 9584..9613 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind complement(9620..9639) /label=lac operator (symmetric) /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG). The symmetric lac operator was optimized for tight binding of lac repressor." RBS 9656..9664 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 9668..12031 /codon_start=1 /product="protease" /label=protease /note="derived from Mesoplasma florum lon codon optimized" /protein_id="ALP32215.1" /translation="MSKKIKLPIFQIRGSFIVPGIKENLEVGRKNTLASVNYAIKNSNN QMIAIPQIDASVEKPEFSDLHEFGILIDFEVIKEWKDNSLTISTNPIQRCKVISFFENE DQVPYAEVELIESINDFSDEELKELIEKISDAIKTKASLVTKQIKQLISGESDDLSLAF DSIMFKLAPSKILTNPEYITSPSLKTRWSIIEKIIFAEDGIITRNAESIDAARQKNEIE QELNHKLKEKMDKQQKEYYLREKMRIIKDELEDEDDSDDSSLEKYKERLAKEPFPEEVK RKIMASIKRVEALQSGTPEWNTEKNYIDWMMSIPWWEETEDLTDLKYAKKILDKHHYGM KKVKERIIEYLAVKTKTKSLKAPIITLVGPPGVGKTSLAKSIAEAVGKNFVKVSLGGVK DESEIRGHRKTYVGSMPGRIIQTMKRAKVKNPLFLLDEIDKMASDHRGDPASAMLEVLD PEQNKEFSDHYIEEPYDLSQVMFIATANYPEDIPEALYDRMEIINLSSYTEIEKVKIAQ DYLVPKAIEQHELTSEEISFTEGAINEIIKYYTREAGVRQLERHINSIIRKYIVKNLNG EMDKIVIDEKQVNDLLGKRIFDHTEKQEESQIGVVTGLAYTQFGGDILPIEVSLYPGKG NLILTGKLGEVMKESATIALTYVKSNFEKFGVDKKVFEENDIHVHVPEGAVPKDGPSAG ITITTALISALSDKPVSKEIGMTGEITLRGNVLPIGGLREKSISASRSGLKTIIIPKKN ERDLDEIPDEVKAKLKIIPAEKYEEVFAIVFKTK" terminator 12068..12154 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.