Basic Vector Information
- Vector Name:
- pDhtSK MCD KO
- Antibiotic Resistance:
- Kanamycin
- Length:
- 11476 bp
- Type:
- UNVERIFIED: Cloning vector
- Replication origin:
- ori
- Source/Author:
- Feng J.
- Promoter:
- lac
pDhtSK MCD KO vector Vector Map
pDhtSK MCD KO vector Sequence
LOCUS 40924_14700 11476 bp DNA circular SYN 18-DEC-2018 DEFINITION UNVERIFIED: Cloning vector pDhtSK MCD KO, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11476) AUTHORS Feng J. TITLE Direct Submission JOURNAL Submitted (29-JAN-2018) Sun Yat-sen Memorial Hospital, Sun Yat-sen University, Department of Dermatology, 107 West Yanjiang Rd, Guangzhou, Guangdong 510120, China REFERENCE 2 (bases 1 to 11476) TITLE Direct Submission REFERENCE 3 (bases 1 to 11476) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (29-JAN-2018) Sun Yat-sen Memorial Hospital, Sun Yat-sen University, Department of Dermatology, 107 West Yanjiang Rd, Guangzhou, Guangdong 510120, China" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## GenBank staff is unable to verify sequence and/or annotation provided by the submitter. FEATURES Location/Qualifiers source 1..11476 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal complement(76..250) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" protein_bind 558..579 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 594..624 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 632..648 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 656..672 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 693..711 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind 748..764 /label=SK primer /note="common sequencing primer, one of multiple similar variants" primer_bind complement(4794..4810) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(4836..4854) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4864..4880) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 5173..5197 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 6497..7123 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 7560..8624 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" rep_origin 8693..8887 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 9231..9371 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(9557..10145) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(10235..11026) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" misc_feature 11451..11475 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA"
This page is informational only.