Basic Vector Information
- Vector Name:
- pDGO77
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8705 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hon S, Holwerda EK, Worthen RS, Maloney MI, Tian L, Cui J, Lin PP, Lynd LR, Olson DG.
pDGO77 vector Vector Map
pDGO77 vector Sequence
LOCUS V007997 8705 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V007997 VERSION V007997 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8705) AUTHORS Hon S, Holwerda EK, Worthen RS, Maloney MI, Tian L, Cui J, Lin PP, Lynd LR, Olson DG. TITLE Expressing the Thermoanaerobacterium saccharolyticum pforA in engineered Clostridium thermocellum improves ethanol production JOURNAL Biotechnol Biofuels 11, 242 (2018) PUBMED 30202437 REFERENCE 2 (bases 1 to 8705) AUTHORS Hon S, Olson DG, Holwerda EK, Worthen RS, Maloney MI, Tian L, Cui J, Lin PP, Lynd LR. TITLE Direct Submission JOURNAL Submitted (20-APR-2018) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8705) TITLE Direct Submission REFERENCE 4 (bases 1 to 8705) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol Biofuels 11, 242 (2018)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-APR-2018) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8705 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(60..648) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(735..1313) /codon_start=1 /gene="tdk" /product="thymidine kinase" /label="tdk" /protein_id="AYA22189.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(735..1313) /gene="tdk" /label="tdk" regulatory complement(1314..1934) /label="C. thermocellum cbp promoter" /note="C. thermocellum cbp promoter" /regulatory_class="promoter" CDS complement(2013..3014) /label="repB" /note="RepB replication protein" rep_origin complement(3015..3469) /direction=LEFT /label="C. thermocellum origin of replication" /note="C. thermocellum origin of replication" CDS complement(3575..4432) /label="AmpR" /note="beta-lactamase" promoter complement(4433..4537) /label="AmpR promoter" misc_feature 4627..5171 /label="upstream homology recombination flank" /note="upstream homology recombination flank" misc_feature 5172..5711 /label="downstream homology recombination flank" /note="downstream homology recombination flank" regulatory 5715..6289 /label="C. thermocellum gapdh promoter" /note="C. thermocellum gapdh promoter" /regulatory_class="promoter" CDS 6290..6937 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 6958..7503 /codon_start=1 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="AYA22193.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 6958..7503 /gene="hpt" /label="hpt" misc_feature 7688..8284 /label="gene target internal homology recombination flank" /note="gene target internal homology recombination flank" terminator 8317..8505 /label="CYC1 terminator" /note="transcription terminator for CYC1"
This page is informational only.