Basic Vector Information
- Vector Name:
- pDGO75
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8653 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Olson DG.
pDGO75 vector Map
pDGO75 vector Sequence
LOCUS V007998 8653 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V007998 VERSION V007998 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8653) AUTHORS Olson DG. TITLE Conversion of phosphoenolpyruvate to pyruvate in Clostridium thermocellum JOURNAL Unpublished REFERENCE 2 (bases 1 to 8653) AUTHORS Olson DG. TITLE Direct Submission JOURNAL Submitted (08-FEB-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8653) TITLE Direct Submission REFERENCE 4 (bases 1 to 8653) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-FEB-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8653 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(1..455) /direction=LEFT /label="C. thermocellum replication origin" /note="C. thermocellum replication origin" CDS complement(561..1418) /label="AmpR" /note="beta-lactamase" promoter complement(1419..1523) /label="AmpR promoter" CDS 3279..3926 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 3947..4492 /codon_start=1 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /note="Hpt; counterselection with 8AZH" /protein_id="AOC59197.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 3947..4492 /gene="hpt" /label="hpt" terminator 5251..5439 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(5699..6287) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6374..6952) /codon_start=1 /gene="tdk" /product="thymidine kinase" /label="tdk" /note="Tdk; counterselection with FUDR" /protein_id="AOC59194.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(6374..6952) /gene="tdk" /label="tdk" CDS complement(7652..8653) /label="repB" /note="RepB replication protein"
This page is informational only.