Basic Vector Information
- Vector Name:
- pDGO134
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9473 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Olson DG.
pDGO134 vector Map
pDGO134 vector Sequence
LOCUS V008002 9473 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V008002 VERSION V008002 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9473) AUTHORS Olson DG. TITLE Conversion of phosphoenolpyruvate to pyruvate in Clostridium thermocellum JOURNAL Unpublished REFERENCE 2 (bases 1 to 9473) AUTHORS Olson DG. TITLE Direct Submission JOURNAL Submitted (06-FEB-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9473) TITLE Direct Submission REFERENCE 4 (bases 1 to 9473) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-FEB-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9473 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(4..1005) /label="repB" /note="RepB replication protein" rep_origin complement(1006..1460) /direction=LEFT /label="C. thermocellum replication origin" /note="C. thermocellum replication origin" CDS complement(1566..2423) /label="AmpR" /note="beta-lactamase" promoter complement(2424..2528) /label="AmpR promoter" CDS 4857..5504 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 5525..6070 /codon_start=1 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /note="Hpt; counterselection with 8AZH" /protein_id="AOC59192.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 5525..6070 /gene="hpt" /label="hpt" misc_feature 6255..7043 /note="partial pyruvate kinase gene from T. saccharolyticum" terminator 7076..7264 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(7524..8112) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8199..8777) /codon_start=1 /gene="tdk" /product="thymidine kinase" /label="tdk" /note="Tdk; counterselection with FUDR" /protein_id="AOC59190.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(8199..8777) /gene="tdk" /label="tdk"
This page is informational only.