Basic Vector Information
- Vector Name:
- pDGO126'ins'_p2638-1705
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5412 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Tian L, Lo J, Shao X, Zheng T, Olson DG, Lynd LR.
pDGO126'ins'_p2638-1705 vector Map
pDGO126'ins'_p2638-1705 vector Sequence
LOCUS V008003 5412 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V008003 VERSION V008003 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5412) AUTHORS Tian L, Lo J, Shao X, Zheng T, Olson DG, Lynd LR. TITLE Identification of a ferredoxin:NAD+ oxidoreductase enzyme in Thermoanaerobacterium saccharolyticum and its role in ethanol formation JOURNAL Appl. Environ. Microbiol. (2016) In press PUBMED 27694237 REFERENCE 2 (bases 1 to 5412) AUTHORS Tian L. TITLE Direct Submission JOURNAL Submitted (22-MAY-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 5412) TITLE Direct Submission REFERENCE 4 (bases 1 to 5412) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol. (2016) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-MAY-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Dr, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5412 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(68..925) /label="AmpR" /note="beta-lactamase" promoter complement(926..1017) /label="AmpR promoter" rep_origin 1617..2162 /direction=RIGHT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS 2633..3634 /label="repB" /note="RepB replication protein" regulatory 3679..3887 /label="P2638" /note="P2638" /regulatory_class="promoter" CDS 3888..4619 /codon_start=1 /product="putative ferredoxin:NAD+ oxidoreductase" /EC_number="1.18.1.2" /label="putative ferredoxin:NAD+ oxidoreductase" /note="Tsac_1705" /protein_id="AOU74527.1" /translation="MRYVVRENREISNGIYRLRLEFDGIPTPGQFIMINCGGNTLLKRP FSICDHDADEITIVYRIKGKGTYNLSKVKALDTLEVTGPHGHGFDMFDKFNNILIVGGG IGIPPLLFLSKKLKSKNLKIALGFKSDVFLVDEFKKYGDVVIATEDGNTGIKGYVTDAM KDEIKDIDMIYGCGPMQMLKSVKDMAEKYDVPCQISIEEHMGCGIGACMVCACKTKTDS GFQYKKVCKDGPVFWSREVVF" CDS 4749..5396 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485"
This page is informational only.