Basic Vector Information
- Vector Name:
- pDGO-68
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7023 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Olson DG.
pDGO-68 vector Map
pDGO-68 vector Sequence
LOCUS V008004 7023 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V008004 VERSION V008004 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7023) AUTHORS Olson DG. TITLE Conversion of phosphoenolpyruvate to pyruvate in Clostridium thermocellum JOURNAL Unpublished REFERENCE 2 (bases 1 to 7023) AUTHORS Olson DG. TITLE Direct Submission JOURNAL Submitted (05-FEB-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 7023) TITLE Direct Submission REFERENCE 4 (bases 1 to 7023) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-FEB-2016) Thayer School of Engineering, Dartmouth College, 14 Engineering Drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7023 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(1..455) /direction=LEFT /label="C. thermocellum replication origin" /note="C. thermocellum replication origin" CDS complement(561..1418) /label="AmpR" /note="beta-lactamase" promoter complement(1419..1523) /label="AmpR promoter" CDS 2191..2838 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 2859..3404 /codon_start=1 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /note="Hpt; counterselection with 8AZH" /protein_id="AOC59180.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 2859..3404 /gene="hpt" /label="hpt" terminator 3621..3809 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(4069..4657) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4744..5322) /codon_start=1 /gene="tdk" /product="thymidine kinase" /label="tdk" /note="Tdk; marker for 5FOA counter selection" /protein_id="AOC59182.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(4744..5322) /gene="tdk" /label="tdk" CDS complement(6022..7023) /label="repB" /note="RepB replication protein"
This page is informational only.