Basic Vector Information
- Vector Name:
- pDGO-34
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10309 bp
- Type:
- CipA deletion vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR.
- Promoter:
- URA3
pDGO-34 vector Map
pDGO-34 vector Sequence
LOCUS V008008 10309 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V008008 VERSION V008008 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10309) AUTHORS Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR. TITLE Exchange of type II dockerin-containing subunits of the Clostridium thermocellum cellulosome as revealed by SNAP-tags JOURNAL FEMS Microbiol. Lett. 338 (1), 46-53 (2013) PUBMED 23082914 REFERENCE 2 (bases 1 to 10309) AUTHORS Olson DG. TITLE Direct Submission JOURNAL Submitted (14-AUG-2012) Thayer School of Engineering, Dartmouth College, Thayer School of Engineering, Dartmouth College, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 10309) TITLE Direct Submission REFERENCE 4 (bases 1 to 10309) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FEMS Microbiol. Lett."; date: "2013"; volume: "338"; issue: "1"; pages: "46-53" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-AUG-2012) Thayer School of Engineering, Dartmouth College, Thayer School of Engineering, Dartmouth College, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10309 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 11..514 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" misc_feature 680..1214 /label="5' flank (CipA + promoter)" /note="5' flank (CipA + promoter)" misc_feature 1215..1753 /label="3' flank" /note="3' flank" regulatory 1766..2413 /label="gapD promoter from Clostridium thermocellum" /note="gapD promoter from Clostridium thermocellum" /regulatory_class="promoter" CDS 2414..3061 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 3082..3627 /codon_start=1 /gene="hpt" /product="putative hypoxanthine phosphoribosyltransferase" /EC_number="2.4.2.8" /label="hpt" /protein_id="AFU51886.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" gene 3082..3627 /gene="hpt" /label="hpt" terminator 4305..4552 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(4800..5388) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5475..6053) /codon_start=1 /gene="tdk" /product="thymidine kinase" /EC_number="2.7.1.21" /label="tdk" /protein_id="AFU51887.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(5475..6053) /gene="tdk" /label="tdk" regulatory complement(6054..6674) /note="CBP; cellulose-binding protein promoter" /regulatory_class="promoter" CDS complement(6753..7754) /label="repB" /note="RepB replication protein" CDS complement(8315..9172) /label="AmpR" /note="beta-lactamase" CDS complement(9271..10071) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(10072..10292) /label="URA3 promoter"
This page is informational only.