Basic Vector Information
- Vector Name:
- pDGO-03
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 9045 bp
- Type:
- CipA deletion vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR.
- Promoter:
- URA3
pDGO-03 vector Vector Map
pDGO-03 vector Sequence
LOCUS V008009 9045 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V008009 VERSION V008009 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9045) AUTHORS Waller BH, Olson DG, Currie DH, Guss AM, Lynd LR. TITLE Exchange of type II dockerin-containing subunits of the Clostridium thermocellum cellulosome as revealed by SNAP-tags JOURNAL FEMS Microbiol. Lett. 338 (1), 46-53 (2013) PUBMED 23082914 REFERENCE 2 (bases 1 to 9045) AUTHORS Olson DG. TITLE Direct Submission JOURNAL Submitted (13-AUG-2012) Thayer School of Engineering, Dartmouth College, Thayer School of Engineering, Dartmouth College, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 9045) TITLE Direct Submission REFERENCE 4 (bases 1 to 9045) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "FEMS Microbiol. Lett."; date: "2013"; volume: "338"; issue: "1"; pages: "46-53" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-AUG-2012) Thayer School of Engineering, Dartmouth College, Thayer School of Engineering, Dartmouth College, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9045 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(1..589) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(906..1706) /label="URA3" /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" promoter complement(1707..1927) /label="URA3 promoter" misc_feature 1955..2458 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence" misc_feature complement(2503..3041) /label="3' flank" /note="3' flank" misc_feature complement(3042..3583) /label="5' flank" /note="5' flank" regulatory complement(3589..3720) /label="hpt" /note="hpt" /regulatory_class="terminator" CDS complement(3721..4275) /codon_start=1 /gene="hpt" /product="hypoxanthine phosphoribosyltransferase" /label="hpt" /protein_id="AFU51881.1" /translation="MINQIKEILVTREELKNNAKELGKRISSDYEGKELVLIGVLKGGV VFFADLIREITIPIDVDFISVSSYGNSTKSSGVVRIIKDIDIDITNKHVLIVEDLVDTG LTLHYLKSMFEARGPKDVKICTALDKPSRRKVDLEIDYKGITIPDKFVVGYGLDYAEKY RNLPDVCVLDSSVYTDKEDMD" gene complement(3721..4275) /gene="hpt" /label="hpt" CDS complement(4294..4941) /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" regulatory complement(4942..5469) /label="gapDH promoter region" /note="gapDH promoter region" /regulatory_class="promoter" misc_feature complement(5473..6040) /label="internal flank" /note="internal flank" CDS complement(6044..6622) /codon_start=1 /gene="tdk" /product="thymidine kinase" /label="tdk" /note="from Thermoanaerobacterium saccharolyticum" /protein_id="AFU51883.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" gene complement(6044..6622) /gene="tdk" /label="tdk" regulatory complement(6623..7243) /note="CBP; cellulose-binding protein promoter" /regulatory_class="promoter" CDS complement(7353..8354) /label="repB" /note="RepB replication protein"
This page is informational only.