pDCAF2 vector (V008057)

LOCUS       V008057                 7021 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V008057
VERSION     V008057
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7021)
  AUTHORS   Quandt EM, Hammerling MJ, Summers RM, Otoupal PB, Slater B, Alnahhas
            RN, Dasgupta A, Bachman JL, Subramanian MV, Barrick JE.
  TITLE     Decaffeination and measurement of caffeine content by addicted E.
            coli with a refactored N-demethylation operon
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7021)
  AUTHORS   Quandt EM, Hammerling MJ, Summers RM, Otoupal PB, Slater B, Alnahhas
            RN, Dasgupta A, Bachman JL, Subramanian MV, Barrick JE.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-FEB-2013) Chemistry and Biochemistry, The University
            of Texas at Austin, 2500 Speedway A4800, Austin, TX 78712-1639, USA
REFERENCE   3  (bases 1 to 7021)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7021)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (14-FEB-2013) Chemistry and Biochemistry, The University of Texas at
            Austin, 2500 Speedway A4800, Austin, TX 78712-1639, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7021
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      22..56
                     /gene="ndmA"
                     /note="BBa_J23100; derived from BBa_K515105"
                     /regulatory_class="promoter"
     regulatory      65..89
                     /label="derived from BBa_K515105"
                     /note="derived from BBa_K515105"
                     /regulatory_class="ribosome_binding_site"
     RBS             74..82
                     /label="Shine-Dalgarno sequence"
                     /note="full consensus sequence for ribosome-binding sites
                     upstream of start codons in E. coli; complementary to a
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     CDS             90..1142
                     /gene="ndmA"
                     /label="Methylxanthine N1-demethylase NdmA"
                     /note="Methylxanthine N1-demethylase NdmA from Pseudomonas
                     putida. Accession#: H9N289"
     regulatory      1153..1164
                     /label="BBa_B0034"
                     /note="BBa_B0034"
                     /regulatory_class="ribosome_binding_site"
     RBS             1153..1164
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             1171..2235
                     /gene="ndmB"
                     /label="Methylxanthine N3-demethylase NdmB"
                     /note="Methylxanthine N3-demethylase NdmB from Pseudomonas
                     putida. Accession#: H9N290"
     regulatory      2256..2267
                     /label="BBa_B0034"
                     /note="BBa_B0034"
                     /regulatory_class="ribosome_binding_site"
     RBS             2256..2267
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             2274..3128
                     /codon_start=1
                     /gene="ndmC"
                     /product="ndmC"
                     /label="ndmC"
                     /protein_id="AGL91152.1"
                     /translation="MSTDQVIFNDWHPVAALEDVSLDKRYRCRLLGRTVSYVKTSDAVN
                     AHWEESADEIKTIRAKEIYGLLWLSFADKPSEMFDIAEFKEPDRRIVSAGSVRVNVSGL
                     RAIENFLDMAHFPFVHTDILGAEPLTEVEPYNVNYDETVDEIFATECKFPQPKGSATAV
                     EPIDMQYIYRITRPYSAILYKTCPPEPHRWDALGLFIQPVDEDWCIAHTIMCYVDDVNS
                     DQQLRHFQQTIFGQDLMILINQVPKRLPLAASRESPVRADVLATAYRRWLREKGVQYGA
                     LRD"
     gene            2274..3128
                     /gene="ndmC"
                     /label="ndmC"
     regulatory      3136..3147
                     /label="BBa_B0034"
                     /note="BBa_B0034"
                     /regulatory_class="ribosome_binding_site"
     RBS             3136..3147
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             3154..4917
                     /gene="ndmD"
                     /label="Oxidoreductase NdmD"
                     /note="Oxidoreductase NdmD from Pseudomonas putida.
                     Accession#: H9N291"
     misc_feature    4973..4993
                     /label="BioBrick suffix"
                     /note="universal suffix for all parts"
     terminator      4994..5051
                     /label="his operon terminator"
                     /note="This putative transcriptin terminator from the E.
                     coli his operon has a 2-bp deletion introduced during
                     synthesis. Its efficiency has not been determined."
     rep_origin      complement(5246..5834)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     terminator      complement(6017..6111)
                     /label="lambda t0 terminator"
                     /note="transcription terminator from phage lambda"
     CDS             complement(6135..6791)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(6792..6895)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     terminator      complement(6975..7018)
                     /label="bacterial terminator"
                     /note="putative bacterial transcription terminator"
     misc_feature    7021
                     /label="BioBrick prefix"
                     /note="BioBrick prefix for parts that do not start with
                     'ATG'"