Basic Vector Information
- Vector Name:
- pDART
- Antibiotic Resistance:
- Kanamycin
- Length:
- 13621 bp
- Type:
- Cloning vector
- Replication origin:
- RSF1010 oriV
- Source/Author:
- Ryu J, Lee U, Park J, Yoo DH, Ahn JH.
pDART vector Vector Map
pDART vector Sequence
LOCUS 40924_14140 13621 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pDART, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 13621) AUTHORS Ryu J, Lee U, Park J, Yoo DH, Ahn JH. TITLE A Vector System for ABC Transporter-Mediated Secretion and Purification of Recombinant Proteins in Pseudomonas Species JOURNAL Appl. Environ. Microbiol. 81 (5), 1744-1753 (2015) PUBMED 25548043 REFERENCE 2 (bases 1 to 13621) AUTHORS Ryu J, Lee U, Park J, Yoo D-H., Ahn JH. TITLE Direct Submission JOURNAL Submitted (06-NOV-2014) Dept. Biology, Korea Science Academy of KAIST, #899, Tanggam 3-Dong, Busanjin-Gu, Busan 614-822, Korea REFERENCE 3 (bases 1 to 13621) TITLE Direct Submission REFERENCE 4 (bases 1 to 13621) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2015"; volume: "81"; issue: "5"; pages: "1744-1753" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-NOV-2014) Dept. Biology, Korea Science Academy of KAIST, #899, Tanggam 3-Dong, Busanjin-Gu, Busan 614-822, Korea" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..13621 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(1..17) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 1002..1814 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin complement(2631..3025) /direction=LEFT /label=RSF1010 oriV /note="replication origin of the broad-host-range plasmid RSF1010; requires the RSF1010 RepA/B/C proteins for replication (Scholz et al., 1989)" oriT 3367..3454 /label=RSF1010 oriT /note="origin of transfer of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 4693..5661 /label=RSF1010 RepB /note="replication protein B of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 6175..7011 /label=RSF1010 RepA /note="replication protein A of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" CDS 7001..7849 /label=RSF1010 RepC /note="replication protein C of the broad-host-range plasmid RSF1010 (Scholz et al., 1989)" protein_bind 8516..8537 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 8552..8582 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 8590..8606 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 8614..8630 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 8674..10410 /codon_start=1 /product="TliD" /label=TliD /note="ABC protein" /protein_id="AJC64569.1" /translation="MSFGSRKINHYGQAYCRGAFIQGVGEYKSILISVGCFTALINLLM LVPSIYMLQVYDRVLSSQNETTLVMLTLMVVGFFAFIGTLEVIRSFIVIRIGSQLERRF NLRVYKAAFERNLQRGQGHAGQALGDLTLLRQFITGPALFAFFDAPWFPLYLLVIFLFN VWLGVLATAGAVLLIGLACLNEYLTKKPLGEAGAYSQQSSQLATSHLHNAETIQAMGML GALRKRWFAVHSQFLGLQNTASDTGSVITSLSKTLRLCLQSLVLGLGALLVIKGDMTAG MMIAGSILMGRVLSPIDQLIAVWKQWSSAKLAYQRLDDLLREFPPDSEPMKLPAPHGQV SFEQVSAGPPGRRTPTLHQVSFTLGAGEVLGVLGASGSGKSTLARVLVGVWPTLGGTVR LDGADIHRWDREDLGPHIGYLPQDIELFSGSIADNIARFRQADPALVVQAAQQAGVHEL ILRLPHGYDTLLGDNGGGLSGGQKQRVALARALYGGPRLIVLDEPNSNLDTVGEAALAS AIVQMKAQGSSVVLVTHRSSALAQADKLLVLNEGRLQRLARARRCCAHCPASRKHRRKG PV" CDS 10451..11752 /codon_start=1 /product="TliE" /label=TliE /note="membrane fusion protein" /protein_id="AJC64570.1" /translation="MSSLTFEQRDARFFVRMGWLLTVVGAGGFFLWASLAPLDQGIPVQ GTVVVSGKRKAVQTFSPGVVSRILVREGETVKQGQPLFRLDQTQNQADVQSLQAQYRLA WASVARWQSERDNRSSIHFPAELSSNPDPALALVLEGQRQLFSSRREAFAREQAGIRAN IDGATAQLGGMRRARSDLTAQAQSLRDQLSNLQPLADNGYIPRNRLMEYQRQLSQVQQD LAQNTGESGRVEQGILESRLKLQQHSEEYQKEVRSQLADAQLRSLTLEQQLTSAGFDLQ HSEINAPADGIAVNLGVHTEGAVVRAGETLLEIVPQGTRLEVEGHLPVHLVDKVGTHLP VDILFTAFNQSRTPRVPGEVSLISADQMLDEKTGAPYYVLRTTLSDAAEQKLQGLVIKP GMPAEMFVRTGERSLLNYLFKPLLDRAGSALTEE" CDS 11755..13200 /codon_start=1 /product="TliF" /label=TliF /note="outer membrane protein" /protein_id="AJC64571.1" /translation="MRSLLIAVLFSCASAHAAMGPFDVYEQALRNDPVFLGAIKERDAG LENRTIGRAGLLPKLSYNYNKGRNNSQATLPDGRGGNYHDDRNYNSYGSTFSLQQPLFD YEAYANYRKGVAQALFADESFRDKSQALLVRVLTYYTQALFAQDQIDIARAKKKAFEQQ FQQNRHLFEQGEGTRTDILEAESRYELATAEEIEALDEQDAALRELGALIGVQSVNIDD LAPLSPGFAAFSLSPANYDTWHELAISNNPTLASQRQALEVARYEVERNRAGHLPKVTA YASSRQQESDSGNTYNQRYDTNTIGVEVSLPLYAGGGVSASTRQASRAMEQAEYELEGK TRETLIELRRQFSACLSGVSKLRAYQKALTSAEALVVSTRQSILGGERVNLDALNAEQQ LYSTRRDLAQARYDYLMAWTKLHYYAGNLRDTDLAKVDEAFGTKRAEPPAADKPPVANK PPEASRPPVASGLAPPWAAQQPQ" regulatory 11803..11812 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" regulatory 13234..13239 /regulatory_class="ribosome_binding_site" misc_feature 13250..13279 /label=multiple cloning site /note="multiple cloning site" CDS 13280..13291 /label=Factor Xa site /note="Factor Xa recognition and cleavage site"
This page is informational only.