Basic Vector Information
- Vector Name:
- pD-GEX1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6690 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Ergin A, Bussow K, Sieper J, Thiel A, Duchmann R, Adam T.
pD-GEX1 vector Map
pD-GEX1 vector Sequence
LOCUS 40924_14095 6690 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pD-GEX1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6690) AUTHORS Ergin A, Bussow K, Sieper J, Thiel A, Duchmann R, Adam T. TITLE Homologous High-Throughput Expression and Purification of Highly Conserved E. coli Proteins JOURNAL Unpublished REFERENCE 2 (bases 1 to 6690) AUTHORS Ergin A, Adam T, Bussow K. TITLE Direct Submission JOURNAL Submitted (09-FEB-2007) Gastroenterology, Charite Berlin (CBF), Hindenburgdamm 30, Berlin 12200, Germany REFERENCE 3 (bases 1 to 6690) TITLE Direct Submission REFERENCE 4 (bases 1 to 6690) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-FEB-2007) Gastroenterology, Charite Berlin (CBF), Hindenburgdamm 30, Berlin 12200, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6690 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 183..211 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 219..235 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 258..911 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 921..932 /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" CDS 939..959 /codon_start=1 /label=7xHis /note="6xHis affinity tag" /translation="HHHHHHH" protein_bind 969..1092 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter 1118..1148 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 1202..1879 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQAGRNLE DPAY" CDS 2202..2504 /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VPRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" protein_bind complement(2548..2672) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" promoter 2993..3097 /label=AmpR promoter CDS 3098..3955 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 4129..4717 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 4961..5038 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 5039..6118 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" protein_bind 6134..6155 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6170..6200 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6208..6224 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 6244..6417 /codon_start=1 /label=lacZ-alpha /note="LacZ-alpha fragment of beta-galactosidase" /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART DRPSQQLRSLNGE"
This page is informational only.