pCXGFP-1 vector (V008092)

Download GeneBank File(.gb)

LOCUS       40924_13980        6787 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector pCXGFP-1 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6787)
  AUTHORS   Suemizu H.
  TITLE     Expression vector pCXGFP-1 DNA, complete sequence
  JOURNAL   Published Only in Database (2006)
REFERENCE   2  (bases 1 to 6787)
  AUTHORS   Suemizu H.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-NOV-2006) Contact:Hiroshi Suemizu Central Institute 
            for Experimental Animals, Biomedical Research Department; 3-25-12 
            Tonomachi, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan
REFERENCE   3  (bases 1 to 6787)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6787)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Published 
            Only in Database (2006)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-NOV-2006) Contact:Hiroshi Suemizu Central Institute for 
            Experimental Animals, Biomedical Research Department; 3-25-12 
            Tonomachi, Kawasaki-ku, Kawasaki, Kanagawa 210-0821, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6787
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      7..142
                     /label=polyoma virus enhancer
                     /note="polyoma virus enhancer"
                     /regulatory_class="enhancer"
     regulatory      149..281
                     /label=HSV-TK promoter
                     /note="HSV-TK promoter"
                     /regulatory_class="promoter"
     CDS             286..1086
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase from Tn5"
     polyA_signal    1096..1144
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     regulatory      1151..1534
                     /label=CMV IE enhancer
                     /note="CMV IE enhancer"
                     /regulatory_class="enhancer"
     enhancer        1154..1533
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        1536..1811
                     /label=chicken beta-actin promoter
     intron          1812..2820
                     /label=chimeric intron
                     /note="chimera between introns from chicken beta-actin and
                     rabbit beta-globin"
     exon            2821..2874
                     /note="rabbit beta-globin 3rd exon"
     misc_feature    2875..2880
                     /label=cloning site EcoRV
                     /note="cloning site EcoRV"
     CDS             2881..3006
                     /codon_start=1
                     /gene="MICA"
                     /product="truncated MHC class I chain related gene A
                     protein"
                     /label=MICA
                     /note="transmembrane domain; truncated MICA protein"
                     /protein_id="BAF36706.1"
                     /translation="QSHWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSGDPPVAT"
     gene            2881..3006
                     /gene="MICA"
                     /label=MICA
     CDS             3007..3723
                     /label=EGFP
                     /note="enhanced GFP"
     polyA_signal    3876..3931
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     primer_bind     complement(4290..4306)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4314..4330)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4338..4368)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4383..4404)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4462..4658
                     /label=SV40 promoter
                     /note="SV40 early promoter"
     polyA_signal    4664..4798
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(5037..5625)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5799..6656)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(6657..6761)
                     /label=AmpR promoter