Basic Vector Information
- Vector Name:
- pCX4hyg
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6824 bp
- Type:
- Retroviral vector
- Replication origin:
- ori
- Source/Author:
- Akagi T, Sasai K, Hanafusa H.
pCX4hyg vector Map
pCX4hyg vector Sequence
LOCUS 40924_13955 6824 bp DNA circular SYN 17-DEC-2018 DEFINITION Retroviral vector pCX4hyg DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6824) AUTHORS Akagi T, Sasai K, Hanafusa H. TITLE Refractory nature of normal human diploid fibroblasts with respect to oncogene-mediated transformation JOURNAL Proc. Natl. Acad. Sci. U.S.A. 100 (23), 13567-13572 (2003) PUBMED 14597713 REFERENCE 2 (bases 1 to 6824) AUTHORS Akagi T. TITLE Direct Submission JOURNAL Submitted (10-JUN-2002) Tsuyoshi Akagi, Osaka Bioscience Institute, Molecular Oncology; Furuedai 6-2-4, Suita, Osaka 565-0874, Japan (E-mail:takagi@obi.or.jp, Tel:81-6-6872-4834, Fax:81-6-6871-7521) REFERENCE 3 (bases 1 to 6824) TITLE Direct Submission REFERENCE 4 (bases 1 to 6824) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2003"; volume: "100"; issue: "23"; pages: "13567-13572" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (10-JUN-2002) Tsuyoshi Akagi, Osaka Bioscience Institute, Molecular Oncology"; volume: " Furuedai 6-2-4, Suita, Osaka 565-0874, Japan (E-mail:takagi@obi.or.jp, Tel:81-6-6872-4834, Fax"; pages: "81-6-6871-7521" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6824 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 88..467 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" repeat_region 467..762 /label=R-U5 region of MuLV 5' LTR /note="R-U5 region of MuLV 5' LTR" misc_feature 826..1183 /label=MMLV Psi /note="packaging signal of Moloney murine leukemia virus (MMLV)" CDS 1242..1658 /codon_start=1 /label=gag (truncated) /note="truncated Moloney murine leukemia virus (MMLV) gag gene lacking the start codon" /translation="GQTVTTPLSLTLGHWKDVERIAHNQSVDVKKRRWVTFCSAEWPTF NVGWPRDGTFNRDLITQVKIKVFSPGPHGHPDQVPYIVTWEALAFDPPPWVKPFVHPKP PPPLPPSAPSLPLEPPRSTPPRSSLYPALTPSLGA" misc_feature 1668..2042 /label=pol region /note="Moloney murine leukemia virus (MMLV) pol region containing the splice acceptor site" misc_feature 2044..2106 /label=multiple cloning site /note="multiple cloning site" misc_feature 2154..2731 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 2757..3773 /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="KPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRGYV LRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLPET ELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQTV MDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMFGD SQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNF DDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE" LTR 4119..4710 /label=LTR /note="long terminal repeat from Moloney murine leukemia virus" rep_origin complement(5011..5599) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5766..6623) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(6624..6728) /label=AmpR promoter
This page is informational only.