pCtrp vector (V008122)

Download GeneBank File(.gb)

LOCUS       40924_13775        6652 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Yeast two-hybrid vector pCtrp DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6652)
  AUTHORS   Banno H.
  TITLE     Identification of proteins that interact with a plant nuclear 
            protein using the yeast split-Trp sensor
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6652)
  AUTHORS   Banno H.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2014) Contact:Hiroharu Banno Chubu University, 
            Bioscience and Biotechnology; 1200 Matsumoto-cho, Kasugai, Aichi 
            487-8501, Japan Phone :81-568-52-6242
REFERENCE   3  (bases 1 to 6652)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6652)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (04-APR-2014) Contact:Hiroharu Banno Chubu University, Bioscience 
            and Biotechnology"; volume: " 1200 Matsumoto-cho, Kasugai, Aichi 
            487-8501, Japan Phone "; pages: "81-568-52-624"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6652
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    7..40
                     /label=multiple cloning site(MCS)
                     /note="multiple cloning site(MCS)"
     CDS             41..70
                     /codon_start=1
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
                     /translation="EQKLISEEDL"
     CDS             77..106
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             113..142
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             149..178
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     terminator      758..1005
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(1253..1841)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2007..2663)
                     /codon_start=1
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     CDS             complement(3111..3911)
                     /codon_start=1
                     /label=URA3
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
                     /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
                     ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
                     YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
                     YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
                     VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
     promoter        complement(3912..4132)
                     /label=URA3 promoter
     rep_origin      complement(4731..5611)
                     /direction=LEFT
                     /label=2u ori
                     /note="yeast 2u plasmid origin of replication"
     rep_origin      complement(5622..6135)
                     /direction=LEFT
                     /label=M13 ori
                     /note="M13 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        6154..6595
                     /label=GAL1 promoter
                     /note="inducible promoter, regulated by Gal4"
     promoter        6627..6645
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"