Basic Vector Information
- Vector Name:
- pBiFCt-2in1-NN
- Antibiotic Resistance:
- Streptomycin
- Length:
- 12925 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Grefen C, Blatt MR.
- Promoter:
- CaMV 35S
pBiFCt-2in1-NN vector Map
pBiFCt-2in1-NN vector Sequence
LOCUS 40924_6492 12925 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pBiFCt-2in1-NN, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12925)
AUTHORS Grefen C, Blatt MR.
TITLE A 2in1 cloning system enables ratiometric bimolecular fluorescence
complementation (rBiFC)
JOURNAL BioTechniques 53 (5), 311-314 (2012)
PUBMED 23066669
REFERENCE 2 (bases 1 to 12925)
AUTHORS Grefen C.
TITLE Direct Submission
JOURNAL Submitted (28-AUG-2015) ZMBP Developmental Genetics, University of
Tuebingen, Auf der Morgenstelle 32, Tuebingen 72076, Germany
REFERENCE 3 (bases 1 to 12925)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12925)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"BioTechniques"; date: "2012"; volume: "53"; issue: "5"; pages:
"311-314"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(28-AUG-2015) ZMBP Developmental Genetics, University of Tuebingen,
Auf der Morgenstelle 32, Tuebingen 72076, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..12925
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 93..437
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
CDS 531..995
/label=VN155(I152L)
/note="improved N-terminal fragment of mVenus for use in
bimolecular fluorescence complementation (BiFC) (Kodama and
Hu, 2010)"
CDS 1029..1055
/label=HA
/note="HA (human influenza hemagglutinin) epitope tag"
protein_bind 1066..1189
/label=attR3
/note="recombination site for the Gateway(R) LR reaction"
promoter 1224..1254
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1262..1278
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 1286..1302
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
CDS 1298..1516
/codon_start=1
/product="lacZ"
/label=lacZ
/protein_id="AMD02807.1"
/translation="MTMITPSLHACRSTLEDPRVPSSNSLAVVLQRRDWENPGVTQLNR
LAAHPPFASWRNSEEARTDRPSQQLRS"
protein_bind complement(1563..1687)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
regulatory 1719..1924
/label=T35S terminator
/note="T35S terminator"
/regulatory_class="terminator"
regulatory 1937..2439
/label=CaMV35S plus Omega enhancer
/note="CaMV35S plus Omega enhancer"
/regulatory_class="promoter"
promoter 2014..2358
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
CDS 2446..3120
/label=mRFP1
/note="monomeric derivative of DsRed (Campbell et al.,
2002)"
regulatory 3177..3385
/label=T35S terminator
/note="T35S terminator"
/regulatory_class="terminator"
promoter 3475..3819
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
CDS 3910..4161
/label=VC155
/note="C-terminal fragment of mVenus for use in bimolecular
fluorescence complementation (BiFC) (Kodama and Hu, 2010)"
CDS 4195..4227
/codon_start=1
/product="MYC-tag"
/label=MYC-tag
/protein_id="AMD02810.1"
/translation="MEQKLISEEDL"
CDS 4198..4227
/codon_start=1
/product="Myc (human c-Myc proto-oncogene) epitope tag"
/label=Myc
/translation="EQKLISEEDL"
protein_bind 4246..4370
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
promoter 4395..4425
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
CDS 4479..5135
/label=CmR
/note="chloramphenicol acetyltransferase"
CDS 5480..5782
/label=ccdB
/note="CcdB, a bacterial toxin that poisons DNA gyrase"
protein_bind complement(5826..5950)
/label=attR4
/note="recombination site for the Gateway(R) LR reaction"
regulatory 5982..6187
/label=T35S terminator
/note="T35S terminator"
/regulatory_class="terminator"
misc_feature complement(6275..6299)
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
CDS 6820..7608
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
rep_origin 7857..8445
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(8631..8771)
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(9115..9309)
/direction=LEFT
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(9378..10448)
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
CDS complement(10880..11506)
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
misc_feature complement(12837..12861)
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
This page is informational only.