pBiFCt-2in1-CC vector (V009187)

Basic Vector Information

Vector Name:
pBiFCt-2in1-CC
Antibiotic Resistance:
Streptomycin
Length:
12932 bp
Type:
Cloning vector
Replication origin:
ori
Host:
Plants
Source/Author:
Grefen C, Blatt MR.
Promoter:
CaMV 35S

pBiFCt-2in1-CC vector Vector Map

pBiFCt-2in1-CC12932 bp6001200180024003000360042004800540060006600720078008400900096001020010800114001200012600CaMV 35S promoterattR3lac promoterlac operatorM13 revattR2HAVN155(I152L)T35S terminatorCaMV35S plus Omega enhancermRFP1T35S terminatorCaMV 35S promoterattR1lac UV5 promoterCmRccdBattR4MYC-tagVC155T35S terminatorLB T-DNA repeatSmRoribompVS1 oriVpVS1 RepApVS1 StaARB T-DNA repeat

pBiFCt-2in1-CC vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_6477       12932 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pBiFCt-2in1-CC, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12932)
  AUTHORS   Grefen C, Blatt MR.
  TITLE     A 2in1 cloning system enables ratiometric bimolecular fluorescence 
            complementation (rBiFC)
  JOURNAL   BioTechniques 53 (5), 311-314 (2012)
  PUBMED    23066669
REFERENCE   2  (bases 1 to 12932)
  AUTHORS   Grefen C.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-AUG-2015) ZMBP Developmental Genetics, University of 
            Tuebingen, Auf der Morgenstelle 32, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 12932)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12932)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "BioTechniques"; date: "2012"; volume: "53"; issue: "5"; pages: 
            "311-314"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (28-AUG-2015) ZMBP Developmental Genetics, University of Tuebingen, 
            Auf der Morgenstelle 32, Tuebingen 72076, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..12932
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        93..437
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     protein_bind    532..655
                     /label=attR3
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        690..720
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    728..744
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     752..768
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             764..982
                     /codon_start=1
                     /product="lacZ"
                     /label=lacZ
                     /protein_id="AMD02813.1"
                     /translation="MTMITPSLHACRSTLEDPRVPSSNSLAVVLQRRDWENPGVTQLNR
                     LAAHPPFASWRNSEEARTDRPSQQLRS"
     protein_bind    complement(1029..1153)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             1170..1196
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     CDS             1230..1694
                     /label=VN155(I152L)
                     /note="improved N-terminal fragment of mVenus for use in 
                     bimolecular fluorescence complementation (BiFC) (Kodama and
                     Hu, 2010)"
     regulatory      1726..1931
                     /label=T35S terminator
                     /note="T35S terminator"
                     /regulatory_class="terminator"
     regulatory      1944..2446
                     /label=CaMV35S plus Omega enhancer
                     /note="CaMV35S plus Omega enhancer"
                     /regulatory_class="promoter"
     promoter        2021..2365
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     CDS             2453..3127
                     /label=mRFP1
                     /note="monomeric derivative of DsRed (Campbell et al.,
                     2002)"
     regulatory      3184..3392
                     /label=T35S terminator
                     /note="T35S terminator"
                     /regulatory_class="terminator"
     promoter        3482..3826
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     protein_bind    3920..4044
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        4069..4099
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     CDS             4153..4809
                     /label=CmR
                     /note="chloramphenicol acetyltransferase"
     CDS             5154..5456
                     /label=ccdB
                     /note="CcdB, a bacterial toxin that poisons DNA gyrase"
     protein_bind    complement(5500..5624)
                     /label=attR4
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             5638..5670
                     /codon_start=1
                     /product="MYC-tag"
                     /label=MYC-tag
                     /protein_id="AMD02819.1"
                     /translation="MEQKLISEEDL"
     CDS             5641..5670
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             5710..5961
                     /label=VC155
                     /note="C-terminal fragment of mVenus for use in bimolecular
                     fluorescence complementation (BiFC) (Kodama and Hu, 2010)"
     regulatory      5989..6194
                     /label=T35S terminator
                     /note="T35S terminator"
                     /regulatory_class="terminator"
     misc_feature    complement(6282..6306)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     CDS             6827..7615
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     rep_origin      7864..8452
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(8638..8778)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(9122..9316)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(9385..10455)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(10887..11513)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     misc_feature    complement(12844..12868)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"

This page is informational only.