Basic Vector Information
- Vector Name:
- pBhSV-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5038 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Battisti JM, Raffel SJ, Schwan TG.
pBhSV-2 vector Map
pBhSV-2 vector Sequence
LOCUS 40924_6357 5038 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pBhSV-2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5038) AUTHORS Battisti JM, Raffel SJ, Schwan TG. TITLE A System for Site-Specific Genetic Manipulation of the Relapsing Fever Spirochete Borrelia hermsii JOURNAL Unpublished REFERENCE 2 (bases 1 to 5038) AUTHORS Battisti JM, Raffel SJ, Schwan TG. TITLE Direct Submission JOURNAL Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA REFERENCE 3 (bases 1 to 5038) TITLE Direct Submission REFERENCE 4 (bases 1 to 5038) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain Laboratories, National Institute of Allergy and Infectious Diseases, National Institutes of Health, 903 S. 4th Street, Hamilton, MT 59840, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5038 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(61..649) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(790..1161) /label=BleoR /note="antibiotic-binding protein" CDS complement(1421..2227) /label=KanR /note="aminoglycoside phosphotransferase" regulatory complement(2228..2348) /label=flgB promoter derived from Borrelia hermsii /note="flgB promoter derived from Borrelia hermsii" /regulatory_class="promoter" gene complement(2605..3114) /pseudo /gene="vmp" /label=vmp /note="orfC'" RBS 2684..2692 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 3281..4375 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="similar to gene family 57; orfA" /protein_id="ABS71230.1" /translation="MGNTKKFTNKYQHKLIVLISTLNYMNLKLKKYTQNDILYYFNNNM KKNDQNPIKLKTLQSYLYKLKKEFQVTINYHRHLGVNMGTEIHYELKYSKKECYCIINK QFREKKEERHKKRVNVYLEKTCIKNSSVEKWECSYNIYNNKEEKKDIKEIEKLQVKKYI RKCNFKSDILYSILDLELEKNATIKVCKIIKRTENFIENSIYKRINGIKSNRSKQRELS KILNETRIRLENEGHNGKQLETQIQEVYEQYKNKPHFIIENNKYNDLKKIIGKLKKTVE YTNRNAKENERDVRNNVFSILLEQLRHKVDKSILVSILKGYLNKQDKLTYSKALNNYYY HELLELINNNLDYLKPEKLEIITS" CDS 4385..4945 /codon_start=1 /gene="orfB" /product="hypothetical protein" /label=orfB /note="simlar to gene family 50; orfB" /protein_id="ABS71231.1" /translation="MESILERLKKKESEIKKKNNRNLFVKVEKINNRTIYHTKIMKDLF SFGINKNQRGKFFVSFRELFNQEKIAVFNLFSLRDDDKFLGISYWYRKPIQNVVTRYEE NGIMKASTFSKVYYVEFRFKKGSVCCYIGEITYLLRKEKANKKYYESLVERMINLEKQV YEFYGKKLPNGGIINKWIEKNQK" gene 4385..4945 /gene="orfB" /label=orfB
This page is informational only.